Recombinant Human TDRP Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TDRP-2899H
Product Overview : C8orf42 MS Standard C13 and N15-labeled recombinant protein (NP_778250) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Contributes to normal sperm motility, but not essential for male fertility.
Molecular Mass : 20.2 kDa
AA Sequence : MVWGRAGSWGRVWGGFGGEGAGLVLGVPRPRLSPARPTGPASRRSRRQSVRRPGGTRSHSPTHGRRDAGARLTMWKLGRGRVLLDEPPEEEDGLRGGPPPAAAAAAQAQVQGASFRGWKEVTSLFNKDDEQHLLERCKSPKSKGTNLRLKEELKAEKKSGFWDNLVLKQNIQSKKPDEIEGWEPPKLALEDISADPEDTVGGHPSWSGWEDDAKGSTKYTSLASSANSSRWSLRAAGRLVSIRRQSKGHLTDSPEEAETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TDRP testis development related protein [ Homo sapiens (human) ]
Official Symbol TDRP
Synonyms TDRP; testis development related protein; Inm01; TDRP1; TDRP2; C8orf42; testis development-related protein
Gene ID 157695
mRNA Refseq NM_175075
Protein Refseq NP_778250
MIM 619049
UniProt ID Q86YL5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TDRP Products

Required fields are marked with *

My Review for All TDRP Products

Required fields are marked with *

0
cart-icon
0
compare icon