Recombinant Human TDRP Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TDRP-2899H |
Product Overview : | C8orf42 MS Standard C13 and N15-labeled recombinant protein (NP_778250) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Contributes to normal sperm motility, but not essential for male fertility. |
Molecular Mass : | 20.2 kDa |
AA Sequence : | MVWGRAGSWGRVWGGFGGEGAGLVLGVPRPRLSPARPTGPASRRSRRQSVRRPGGTRSHSPTHGRRDAGARLTMWKLGRGRVLLDEPPEEEDGLRGGPPPAAAAAAQAQVQGASFRGWKEVTSLFNKDDEQHLLERCKSPKSKGTNLRLKEELKAEKKSGFWDNLVLKQNIQSKKPDEIEGWEPPKLALEDISADPEDTVGGHPSWSGWEDDAKGSTKYTSLASSANSSRWSLRAAGRLVSIRRQSKGHLTDSPEEAETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TDRP testis development related protein [ Homo sapiens (human) ] |
Official Symbol | TDRP |
Synonyms | TDRP; testis development related protein; Inm01; TDRP1; TDRP2; C8orf42; testis development-related protein |
Gene ID | 157695 |
mRNA Refseq | NM_175075 |
Protein Refseq | NP_778250 |
MIM | 619049 |
UniProt ID | Q86YL5 |
◆ Recombinant Proteins | ||
TDRP-4662R | Recombinant Rhesus monkey TDRP Protein, His-tagged | +Inquiry |
TDRP-508H | Recombinant Human TDRP Protein, MYC/DDK-tagged | +Inquiry |
TDRP-2899H | Recombinant Human TDRP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Tdrp-6351M | Recombinant Mouse Tdrp Protein, Myc/DDK-tagged | +Inquiry |
TDRP-4478R | Recombinant Rhesus Macaque TDRP Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TDRP Products
Required fields are marked with *
My Review for All TDRP Products
Required fields are marked with *
0
Inquiry Basket