Recombinant Human TDRP Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | TDRP-2899H |
| Product Overview : | C8orf42 MS Standard C13 and N15-labeled recombinant protein (NP_778250) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Contributes to normal sperm motility, but not essential for male fertility. |
| Molecular Mass : | 20.2 kDa |
| AA Sequence : | MVWGRAGSWGRVWGGFGGEGAGLVLGVPRPRLSPARPTGPASRRSRRQSVRRPGGTRSHSPTHGRRDAGARLTMWKLGRGRVLLDEPPEEEDGLRGGPPPAAAAAAQAQVQGASFRGWKEVTSLFNKDDEQHLLERCKSPKSKGTNLRLKEELKAEKKSGFWDNLVLKQNIQSKKPDEIEGWEPPKLALEDISADPEDTVGGHPSWSGWEDDAKGSTKYTSLASSANSSRWSLRAAGRLVSIRRQSKGHLTDSPEEAETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | TDRP testis development related protein [ Homo sapiens (human) ] |
| Official Symbol | TDRP |
| Synonyms | TDRP; testis development related protein; Inm01; TDRP1; TDRP2; C8orf42; testis development-related protein |
| Gene ID | 157695 |
| mRNA Refseq | NM_175075 |
| Protein Refseq | NP_778250 |
| MIM | 619049 |
| UniProt ID | Q86YL5 |
| ◆ Recombinant Proteins | ||
| TDRP-508H | Recombinant Human TDRP Protein, MYC/DDK-tagged | +Inquiry |
| TDRP-4478R | Recombinant Rhesus Macaque TDRP Protein, His (Fc)-Avi-tagged | +Inquiry |
| TDRP-557HFL | Recombinant Full Length Human TDRP Protein, C-Flag-tagged | +Inquiry |
| TDRP-2171H | Recombinant Human TDRP Protein, His (Fc)-Avi-tagged | +Inquiry |
| TDRP-2899H | Recombinant Human TDRP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TDRP Products
Required fields are marked with *
My Review for All TDRP Products
Required fields are marked with *



