Recombinant Full Length Human TDRP Protein, C-Flag-tagged

• Cat.No.: TDRP-557HFL
• Product Overview: Recombinant Full Length Human TDRP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Acts upstream of or within spermatogenesis. Located in cytosol and nucleus.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 20.2 kDa
• AA Sequence: MVWGRAGSWGRVWGGFGGEGAGLVLGVPRPRLSPARPTGPASRRSRRQSVRRPGGTRSHSPTHGRRDAGA RLTMWKLGRGRVLLDEPPEEEDGLRGGPPPAAAAAAQAQVQGASFRGWKEVTSLFNKDDEQHLLERCKSP KSKGTNLRLKEELKAEKKSGFWDNLVLKQNIQSKKPDEIEGWEPPKLALEDISADPEDTVGGHPSWSGWE
  DDAKGSTKYTSLASSANSSRWSLRAAGRLVSIRRQSKGHLTDSPEEAETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: TDRP testis development related protein [ Homo sapiens (human) ]
• Official Symbol: TDRP
• Synonyms: Inm01; TDRP1; TDRP2; C8orf42
• Gene ID: 157695
• mRNA Refseq: NM_175075.5
• Protein Refseq: NP_778250.2
• MIM: 619049
• UniProt ID: Q86YL5