Recombinant Full Length Human TDRP Protein, C-Flag-tagged
Cat.No. : | TDRP-557HFL |
Product Overview : | Recombinant Full Length Human TDRP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Acts upstream of or within spermatogenesis. Located in cytosol and nucleus. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 20.2 kDa |
AA Sequence : | MVWGRAGSWGRVWGGFGGEGAGLVLGVPRPRLSPARPTGPASRRSRRQSVRRPGGTRSHSPTHGRRDAGA RLTMWKLGRGRVLLDEPPEEEDGLRGGPPPAAAAAAQAQVQGASFRGWKEVTSLFNKDDEQHLLERCKSP KSKGTNLRLKEELKAEKKSGFWDNLVLKQNIQSKKPDEIEGWEPPKLALEDISADPEDTVGGHPSWSGWE DDAKGSTKYTSLASSANSSRWSLRAAGRLVSIRRQSKGHLTDSPEEAETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | TDRP testis development related protein [ Homo sapiens (human) ] |
Official Symbol | TDRP |
Synonyms | Inm01; TDRP1; TDRP2; C8orf42 |
Gene ID | 157695 |
mRNA Refseq | NM_175075.5 |
Protein Refseq | NP_778250.2 |
MIM | 619049 |
UniProt ID | Q86YL5 |
◆ Recombinant Proteins | ||
Tdrp-6351M | Recombinant Mouse Tdrp Protein, Myc/DDK-tagged | +Inquiry |
TDRP-4662R | Recombinant Rhesus monkey TDRP Protein, His-tagged | +Inquiry |
TDRP-508H | Recombinant Human TDRP Protein, MYC/DDK-tagged | +Inquiry |
TDRP-4478R | Recombinant Rhesus Macaque TDRP Protein, His (Fc)-Avi-tagged | +Inquiry |
TDRP-2171H | Recombinant Human TDRP Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TDRP Products
Required fields are marked with *
My Review for All TDRP Products
Required fields are marked with *
0
Inquiry Basket