Recombinant Human TEAD2 protein, GST-tagged

• Cat.No.: TEAD2-26H
• Product Overview: Recombinant Human TEAD2(218 a.a. - 307 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 218 a.a. - 307 a.a.
• Description: TEAD2 played an important role in many functions.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 35.64 kDa
• AA Sequence: WQARGLGTARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDVRQIYDKFPEKKGGLRELYDRGPPHAFFLVKFWADLN
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: TEAD2 TEA domain family member 2 [ Homo sapiens ]
• Official Symbol: TEAD2
• Synonyms: TEAD2; TEA domain family member 2; transcriptional enhancer factor TEF-4; ETF; TEF 4; TEF4; TEF-4; TEAD-2
• Gene ID: 8463
• mRNA Refseq: NM_001256660
• Protein Refseq: NP_001243589
• MIM: 601729
• UniProt ID: Q15562
• Chromosome Location: 19q13.3
• Pathway: Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; PPARA Activates Gene Expression, organism-specific biosystem; Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha), organism-specific biosystem
• Function: DNA binding; protein binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity