Recombinant Human TEAD2 protein, GST-tagged
Cat.No. : | TEAD2-26H |
Product Overview : | Recombinant Human TEAD2(218 a.a. - 307 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 218 a.a. - 307 a.a. |
Description : | TEAD2 played an important role in many functions. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 35.64 kDa |
AA Sequence : | WQARGLGTARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDVRQIYDKFPEKKGGLRELYDRGPPHAFFLVKFWADLN |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TEAD2 TEA domain family member 2 [ Homo sapiens ] |
Official Symbol | TEAD2 |
Synonyms | TEAD2; TEA domain family member 2; transcriptional enhancer factor TEF-4; ETF; TEF 4; TEF4; TEF-4; TEAD-2; |
Gene ID | 8463 |
mRNA Refseq | NM_001256660 |
Protein Refseq | NP_001243589 |
MIM | 601729 |
UniProt ID | Q15562 |
Chromosome Location | 19q13.3 |
Pathway | Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; PPARA Activates Gene Expression, organism-specific biosystem; Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha), organism-specific biosystem; |
Function | DNA binding; protein binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; |
◆ Recombinant Proteins | ||
TEAD2-754H | Recombinant Human TEAD2 protein, His&Myc-tagged | +Inquiry |
TEAD2-16618M | Recombinant Mouse TEAD2 Protein | +Inquiry |
TEAD1-02H | Recombinant human TEA domain transcription factor 1 protein, His-tagged | +Inquiry |
TEAD2-26H | Recombinant Human TEAD2 protein, GST-tagged | +Inquiry |
TEAD2-33H | Recombinant Human TEAD2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TEAD2-1757HCL | Recombinant Human TEAD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TEAD2 Products
Required fields are marked with *
My Review for All TEAD2 Products
Required fields are marked with *