Recombinant Human TEAD2 protein, GST-tagged
| Cat.No. : | TEAD2-26H |
| Product Overview : | Recombinant Human TEAD2(218 a.a. - 307 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 218 a.a. - 307 a.a. |
| Description : | TEAD2 played an important role in many functions. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 35.64 kDa |
| AA Sequence : | WQARGLGTARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDVRQIYDKFPEKKGGLRELYDRGPPHAFFLVKFWADLN |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | TEAD2 TEA domain family member 2 [ Homo sapiens ] |
| Official Symbol | TEAD2 |
| Synonyms | TEAD2; TEA domain family member 2; transcriptional enhancer factor TEF-4; ETF; TEF 4; TEF4; TEF-4; TEAD-2; |
| Gene ID | 8463 |
| mRNA Refseq | NM_001256660 |
| Protein Refseq | NP_001243589 |
| MIM | 601729 |
| UniProt ID | Q15562 |
| Chromosome Location | 19q13.3 |
| Pathway | Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; PPARA Activates Gene Expression, organism-specific biosystem; Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha), organism-specific biosystem; |
| Function | DNA binding; protein binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; |
| ◆ Recombinant Proteins | ||
| TEAD1-02H | Recombinant human TEA domain transcription factor 1 protein, His-tagged | +Inquiry |
| TEAD2-16618M | Recombinant Mouse TEAD2 Protein | +Inquiry |
| TEAD212933H | Recombinant Human TEAD2 (217-447) Protein | +Inquiry |
| TEAD2-35H | Recombinant Human TEAD2 protein, His-Myc-tagged | +Inquiry |
| TEAD2-34H | Recombinant Human TEAD2 protein, His/Sumo-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TEAD2-1757HCL | Recombinant Human TEAD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TEAD2 Products
Required fields are marked with *
My Review for All TEAD2 Products
Required fields are marked with *



