Recombinant Human TEAD2 protein, His-tagged
Cat.No. : | TEAD2-33H |
Product Overview : | Recombinant Human TEAD2 protein(121-251 aa), fused with His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 121-251 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | DQVSKDKAFQTMATMSSAQLISAPSLQAKLGPTGPQVVQASELFQFWSGGSGPPWNVPDVKPFSQTPFTLSLTPPSTDLPGYEPPQALSPLPPPTPSPPAWQARGLGTARLQLVEFSAFVEPPDAVDSYQR |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TEAD2 TEA domain family member 2 [ Homo sapiens ] |
Official Symbol | TEAD2 |
Synonyms | TEAD2; TEA domain family member 2; transcriptional enhancer factor TEF-4; ETF; TEF 4; TEF4; TEF-4; TEAD-2; |
Gene ID | 8463 |
mRNA Refseq | NM_001256658 |
Protein Refseq | NP_001243587 |
MIM | 601729 |
UniProt ID | Q15562 |
◆ Recombinant Proteins | ||
TEAD2-34H | Recombinant Human TEAD2 protein, His/Sumo-tagged | +Inquiry |
TEAD2-33H | Recombinant Human TEAD2 protein, His-tagged | +Inquiry |
TEAD2-35H | Recombinant Human TEAD2 protein, His-Myc-tagged | +Inquiry |
TEAD2-08H | Recombinant Human TEAD2 Protein, His-tagged | +Inquiry |
TEAD2-9115M | Recombinant Mouse TEAD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TEAD2-1757HCL | Recombinant Human TEAD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TEAD2 Products
Required fields are marked with *
My Review for All TEAD2 Products
Required fields are marked with *
0
Inquiry Basket