Recombinant Human TEAD2 protein, His-tagged
| Cat.No. : | TEAD2-33H |
| Product Overview : | Recombinant Human TEAD2 protein(121-251 aa), fused with His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 121-251 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | DQVSKDKAFQTMATMSSAQLISAPSLQAKLGPTGPQVVQASELFQFWSGGSGPPWNVPDVKPFSQTPFTLSLTPPSTDLPGYEPPQALSPLPPPTPSPPAWQARGLGTARLQLVEFSAFVEPPDAVDSYQR |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | TEAD2 TEA domain family member 2 [ Homo sapiens ] |
| Official Symbol | TEAD2 |
| Synonyms | TEAD2; TEA domain family member 2; transcriptional enhancer factor TEF-4; ETF; TEF 4; TEF4; TEF-4; TEAD-2; |
| Gene ID | 8463 |
| mRNA Refseq | NM_001256658 |
| Protein Refseq | NP_001243587 |
| MIM | 601729 |
| UniProt ID | Q15562 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TEAD2 Products
Required fields are marked with *
My Review for All TEAD2 Products
Required fields are marked with *



