Recombinant Human TEAD3 Protein, His-SUMO-tagged
| Cat.No. : | TEAD3-1382H |
| Product Overview : | Recombinant Human TEAD3 Protein (112-435aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 112-435 a.a. |
| Description : | This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is predominantly expressed in the placenta and is involved in the transactivation of the chorionic somatomammotropin-B gene enhancer. Translation of this protein is initiated at a non-AUG (AUA) start codon. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 52.3 kDa |
| AA Sequence : | MNLDQVSKDKALQSMASMSSAQIVSASVLQNKFSPPSPLPQAVFSTSSRFWSSPPLLGQQPGPSQDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVETEYARLENGRFVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | TEAD3 TEA domain transcription factor 3 [ Homo sapiens (human) ] |
| Official Symbol | TEAD3 |
| Synonyms | TEF5; TEAD5; TEF-5; DTEF-1; ETFR-1; TEAD-3 |
| Gene ID | 7005 |
| mRNA Refseq | NM_003214.3 |
| Protein Refseq | NP_003205.2 |
| MIM | 603170 |
| UniProt ID | Q99594 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TEAD3 Products
Required fields are marked with *
My Review for All TEAD3 Products
Required fields are marked with *




