Recombinant Human TEAD3 Protein, His-SUMO-tagged
Cat.No. : | TEAD3-1382H |
Product Overview : | Recombinant Human TEAD3 Protein (112-435aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 112-435 a.a. |
Description : | This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is predominantly expressed in the placenta and is involved in the transactivation of the chorionic somatomammotropin-B gene enhancer. Translation of this protein is initiated at a non-AUG (AUA) start codon. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 52.3 kDa |
AA Sequence : | MNLDQVSKDKALQSMASMSSAQIVSASVLQNKFSPPSPLPQAVFSTSSRFWSSPPLLGQQPGPSQDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVETEYARLENGRFVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | TEAD3 TEA domain transcription factor 3 [ Homo sapiens (human) ] |
Official Symbol | TEAD3 |
Synonyms | TEF5; TEAD5; TEF-5; DTEF-1; ETFR-1; TEAD-3 |
Gene ID | 7005 |
mRNA Refseq | NM_003214.3 |
Protein Refseq | NP_003205.2 |
MIM | 603170 |
UniProt ID | Q99594 |
◆ Recombinant Proteins | ||
Tead3-4841M | Recombinant Mouse Tead3 protein, Avi-tagged, Biotinylated | +Inquiry |
TEAD3-1382H | Recombinant Human TEAD3 Protein, His-SUMO-tagged | +Inquiry |
TEAD3-27H | Recombinant Human TEAD3 protein, GST-tagged | +Inquiry |
Tead3-4843M | Recombinant Mouse Tead3 protein | +Inquiry |
TEAD3-28H | Recombinant Human TEAD3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TEAD3-1154HCL | Recombinant Human TEAD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TEAD3 Products
Required fields are marked with *
My Review for All TEAD3 Products
Required fields are marked with *
0
Inquiry Basket