Recombinant Human TEAD4 protein, His&Myc-tagged

Cat.No. : TEAD4-4585H
Product Overview : Recombinant Human TEAD4 protein(Q15561)(74-434aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His&Myc
Protein Length : 74-434aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 44.5 kDa
AA Sequence : MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name TEAD4 TEA domain family member 4 [ Homo sapiens ]
Official Symbol TEAD4
Synonyms TEAD4; TEA domain family member 4; TCF13L1; transcriptional enhancer factor TEF-3; EFTR 2; RTEF 1; TEF 3; TEFR 1; transcription factor RTEF-1; transcription factor 13-like 1; transcriptional enhancer factor 3; related transcription enhancer factor 1B; transcriptional enhancer factor 1-related; TEF3; RTEF1; TEF-3; EFTR-2; TEFR-1; hRTEF-1B; MGC9014;
Gene ID 7004
mRNA Refseq NM_003213
Protein Refseq NP_003204
MIM 601714
UniProt ID Q15561

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TEAD4 Products

Required fields are marked with *

My Review for All TEAD4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon