Recombinant Human TESC protein, His-SUMO-tagged
Cat.No. : | TESC-3561H |
Product Overview : | Recombinant Human TESC protein(Q96BS2)(2-214aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-214aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 40.6 kDa |
AA Sequence : | GAAHSASEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNPIRSKIVRAFFDNRNLRKGPSGLADEINFEDFLTIMSYFRPIDTTMDEEQVELSRKEKLRFLFHMYDSDSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQMEPDQVYEGITFEDFLKIWQGIDIETKMHVRFLNMETMALCH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TESC tescalcin [ Homo sapiens ] |
Official Symbol | TESC |
Synonyms | TESC; tescalcin; FLJ20607; TSC; calcineurin B homologous protein 3; CHP3; |
Gene ID | 54997 |
mRNA Refseq | NM_001168325 |
Protein Refseq | NP_001161797 |
MIM | 611585 |
UniProt ID | Q96BS2 |
◆ Recombinant Proteins | ||
Tesc-6361M | Recombinant Mouse Tesc Protein, Myc/DDK-tagged | +Inquiry |
TESC-4483R | Recombinant Rhesus Macaque TESC Protein, His (Fc)-Avi-tagged | +Inquiry |
TESC-4667R | Recombinant Rhesus monkey TESC Protein, His-tagged | +Inquiry |
TESC-658H | Recombinant Human TESC Protein, MYC/DDK-tagged | +Inquiry |
TESC-3182H | Recombinant Human TESC, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TESC Products
Required fields are marked with *
My Review for All TESC Products
Required fields are marked with *