Recombinant Human TEX26 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | TEX26-4371H |
| Product Overview : | C13orf26 MS Standard C13 and N15-labeled recombinant protein (NP_689538) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | TEX26 (Testis Expressed 26) is a Protein Coding gene. |
| Molecular Mass : | 33.6 kDa |
| AA Sequence : | MEQPGPRAPDPSLCHHNLQPTDDPNWDSYATTMRTAFTPKTGAVPALIRQNGIRRLGYTYSLSDPILNQTQYSDEYTWKSHSKEDLIKTETSRGIKSHKSHLNEDIFLWTLPHCQQTGTLKNCLPWKIPASMKEVNKALSNQFISLTKRDFVDRSKAQKIKKSSHLSLEWKKLLPQPPDTEFRRNYQIPAKIPELQDFSFKYGCYSSLPVASQGLVPSVLHSYLRNQEHTKKQTTYQSDYDKTYPDFLMLLNSFTSSQVKEYLQSLSYKDRQIIDRFIRTHCDTNKKKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | TEX26 testis expressed 26 [ Homo sapiens (human) ] |
| Official Symbol | TEX26 |
| Synonyms | TEX26; testis expressed 26; C13orf26; testis-expressed protein 26; testis-expressed sequence 26 protein |
| Gene ID | 122046 |
| mRNA Refseq | NM_152325 |
| Protein Refseq | NP_689538 |
| UniProt ID | Q8N6G2 |
| ◆ Recombinant Proteins | ||
| Tex26-6365M | Recombinant Mouse Tex26 Protein, Myc/DDK-tagged | +Inquiry |
| TEX26-4371H | Recombinant Human TEX26 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TEX26-8302HCL | Recombinant Human C13orf26 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TEX26 Products
Required fields are marked with *
My Review for All TEX26 Products
Required fields are marked with *
