Recombinant Human TFAM protein, GST-tagged

Cat.No. : TFAM-301323H
Product Overview : Recombinant Human TFAM (50-118 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Pro50-Lys118
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : PKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFK
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name TFAM transcription factor A, mitochondrial [ Homo sapiens ]
Official Symbol TFAM
Synonyms TFAM; transcription factor A, mitochondrial; TCF6, TCF6L2; TCF-6; transcription factor 6; mitochondrial transcription factor 1; mitochondrial transcription factor A; Transcription factor 6-like 2 (mitochondrial transcription factor); TCF6; MtTF1; mtTFA; TCF6L1; TCF6L2; TCF6L3;
Gene ID 7019
mRNA Refseq NM_003201
Protein Refseq NP_003192
MIM 600438
UniProt ID Q00059

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TFAM Products

Required fields are marked with *

My Review for All TFAM Products

Required fields are marked with *

0
cart-icon
0
compare icon