Recombinant Human TFAM protein, GST-tagged
| Cat.No. : | TFAM-301323H |
| Product Overview : | Recombinant Human TFAM (50-118 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Pro50-Lys118 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | PKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFK |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | TFAM transcription factor A, mitochondrial [ Homo sapiens ] |
| Official Symbol | TFAM |
| Synonyms | TFAM; transcription factor A, mitochondrial; TCF6, TCF6L2; TCF-6; transcription factor 6; mitochondrial transcription factor 1; mitochondrial transcription factor A; Transcription factor 6-like 2 (mitochondrial transcription factor); TCF6; MtTF1; mtTFA; TCF6L1; TCF6L2; TCF6L3; |
| Gene ID | 7019 |
| mRNA Refseq | NM_003201 |
| Protein Refseq | NP_003192 |
| MIM | 600438 |
| UniProt ID | Q00059 |
| ◆ Recombinant Proteins | ||
| TFAM-9148M | Recombinant Mouse TFAM Protein, His (Fc)-Avi-tagged | +Inquiry |
| TFAM-7866H | Recombinant Human TFAM protein, His-tagged | +Inquiry |
| Tfam-656R | Recombinant Rat Tfam Protein, His/GST-tagged | +Inquiry |
| TFAM-6414H | Recombinant Human TFAM Protein (Ser43-Cys246), N-GST tagged | +Inquiry |
| TFAM-5676C | Recombinant Chicken TFAM | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TFAM-1765HCL | Recombinant Human TFAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TFAM Products
Required fields are marked with *
My Review for All TFAM Products
Required fields are marked with *
