Recombinant Human TFAM protein, His-tagged
| Cat.No. : | TFAM-7866H |
| Product Overview : | Recombinant Human TFAM protein(Q00059)(43-246aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 43-246aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 28.5 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | SSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC |
| Gene Name | TFAM transcription factor A, mitochondrial [ Homo sapiens ] |
| Official Symbol | TFAM |
| Synonyms | TFAM; transcription factor A, mitochondrial; TCF6, TCF6L2; TCF-6; transcription factor 6; mitochondrial transcription factor 1; mitochondrial transcription factor A; Transcription factor 6-like 2 (mitochondrial transcription factor); TCF6; MtTF1; mtTFA; TCF6L1; TCF6L2; TCF6L3; |
| Gene ID | 7019 |
| mRNA Refseq | NM_003201 |
| Protein Refseq | NP_003192 |
| MIM | 600438 |
| UniProt ID | Q00059 |
| ◆ Recombinant Proteins | ||
| Tfam-2111M | Recombinant Mouse Tfam protein(43-243aa), His&Myc-tagged | +Inquiry |
| Tfam-655M | Recombinant Mouse Tfam Protein, His/GST-tagged | +Inquiry |
| TFAM-4721Z | Recombinant Zebrafish TFAM | +Inquiry |
| TFAM-30255TH | Recombinant Human TFAM, His-tagged | +Inquiry |
| TFAM-6024R | Recombinant Rat TFAM Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TFAM-1765HCL | Recombinant Human TFAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TFAM Products
Required fields are marked with *
My Review for All TFAM Products
Required fields are marked with *
