Recombinant Human TFF2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TFF2-5458H
Product Overview : TFF2 MS Standard C13 and N15-labeled recombinant protein (NP_005414) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. The encoded protein inhibits gastric acid secretion. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21.
Molecular Mass : 14.3 kDa
AA Sequence : MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TFF2 trefoil factor 2 [ Homo sapiens (human) ]
Official Symbol TFF2
Synonyms TFF2; trefoil factor 2; SML1, spasmolytic protein 1; spasmolysin; spasmolytic protein 1; spasmolytic polypeptide; SP; SML1;
Gene ID 7032
mRNA Refseq NM_005423
Protein Refseq NP_005414
MIM 182590
UniProt ID Q03403

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TFF2 Products

Required fields are marked with *

My Review for All TFF2 Products

Required fields are marked with *

0
cart-icon
0
compare icon