Recombinant Human TFPI2 Protein, His tagged

Cat.No. : TFPI2C-65H
Product Overview : Recombinant human TFPI2 (23-213 aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 23-213 aa
Description : This gene encodes a member of the Kunitz-type serine proteinase inhibitor family. The protein can inhibit a variety of serine proteases including factor VIIa/tissue factor, factor Xa, plasmin, trypsin, chymotryspin and plasma kallikrein. This gene has been identified as a tumor suppressor gene in several types of cancer. Alternative splicing results in multiple transcript variants.
Form : Liquid
AASequence : DAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAKALKLEHHHHHH
Molecular Mass : 22.9 kDa
Endotoxin : < 1 EU/μg by LAL
Purity : > 95% by SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Concentration : 0.5 mg/mL (determined by absorbance at 280nm)
Gene ID 7980
Gene Name TFPI2 tissue factor pathway inhibitor 2 [ Homo sapiens (human) ]
Official Symbol 7980
Synonyms TFPI2; tissue factor pathway inhibitor 2; PP5; REF1; TFPI 2; placental protein 5; TFPI-2; FLJ21164;
mRNA Refseq NM_006528
Official Symbol 2 TFPI2
Gene ID 2 7980
Gene Name 2 TFPI2 tissue factor pathway inhibitor 2 [ Homo sapiens (human) ]
mRNA Refseq 2 NM_006528
Protein Refseq 2 NP_006519
MIM 2 600033
UniProt ID 2 P48307

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TFPI2 Products

Required fields are marked with *

My Review for All TFPI2 Products

Required fields are marked with *

0
cart-icon