Recombinant Human TFPI2 Protein, His tagged
| Cat.No. : | TFPI2C-65H |
| Product Overview : | Recombinant human TFPI2 (23-213 aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His |
| Protein Length : | 23-213 aa |
| Description : | This gene encodes a member of the Kunitz-type serine proteinase inhibitor family. The protein can inhibit a variety of serine proteases including factor VIIa/tissue factor, factor Xa, plasmin, trypsin, chymotryspin and plasma kallikrein. This gene has been identified as a tumor suppressor gene in several types of cancer. Alternative splicing results in multiple transcript variants. |
| Form : | Liquid |
| AASequence : | DAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAKALKLEHHHHHH |
| Molecular Mass : | 22.9 kDa |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 95% by SDS-PAGE |
| Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
| Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
| Gene ID | 7980 |
| Gene Name | TFPI2 tissue factor pathway inhibitor 2 [ Homo sapiens (human) ] |
| Official Symbol | 7980 |
| Synonyms | TFPI2; tissue factor pathway inhibitor 2; PP5; REF1; TFPI 2; placental protein 5; TFPI-2; FLJ21164; |
| mRNA Refseq | NM_006528 |
| Official Symbol 2 | TFPI2 |
| Gene ID 2 | 7980 |
| Gene Name 2 | TFPI2 tissue factor pathway inhibitor 2 [ Homo sapiens (human) ] |
| mRNA Refseq 2 | NM_006528 |
| Protein Refseq 2 | NP_006519 |
| MIM 2 | 600033 |
| UniProt ID 2 | P48307 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TFPI2 Products
Required fields are marked with *
My Review for All TFPI2 Products
Required fields are marked with *
