Recombinant Human TFPI2 Protein, His tagged

• Cat.No.: TFPI2C-65H
• Product Overview: Recombinant human TFPI2 (23-213 aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• Protein Length: 23-213 aa
• Description: This gene encodes a member of the Kunitz-type serine proteinase inhibitor family. The protein can inhibit a variety of serine proteases including factor VIIa/tissue factor, factor Xa, plasmin, trypsin, chymotryspin and plasma kallikrein. This gene has been identified as a tumor suppressor gene in several types of cancer. Alternative splicing results in multiple transcript variants.
• Form: Liquid
• AASequence: DAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAKALKLEHHHHHH
• Molecular Mass: 22.9 kDa
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 95% by SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
• Concentration: 0.5 mg/mL (determined by absorbance at 280nm)

Gene Information

• Gene ID: 7980
• Gene Name: TFPI2 tissue factor pathway inhibitor 2 [ Homo sapiens (human) ]
• Official Symbol: 7980
• Synonyms: TFPI2; tissue factor pathway inhibitor 2; PP5; REF1; TFPI 2; placental protein 5; TFPI-2; FLJ21164
• mRNA Refseq: NM_006528
• Official Symbol 2: TFPI2
• Gene ID 2: 7980
• Gene Name 2: TFPI2 tissue factor pathway inhibitor 2 [ Homo sapiens (human) ]
• mRNA Refseq 2: NM_006528
• Protein Refseq 2: NP_006519
• MIM 2: 600033
• UniProt ID 2: P48307