Recombinant Human TFPI2 Protein, His tagged
Cat.No. : | TFPI2C-65H |
Product Overview : | Recombinant human TFPI2 (23-213 aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 23-213 aa |
Description : | This gene encodes a member of the Kunitz-type serine proteinase inhibitor family. The protein can inhibit a variety of serine proteases including factor VIIa/tissue factor, factor Xa, plasmin, trypsin, chymotryspin and plasma kallikrein. This gene has been identified as a tumor suppressor gene in several types of cancer. Alternative splicing results in multiple transcript variants. |
Form : | Liquid |
AASequence : | DAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAKALKLEHHHHHH |
Molecular Mass : | 22.9 kDa |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 95% by SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Gene ID | 7980 |
Gene Name | TFPI2 tissue factor pathway inhibitor 2 [ Homo sapiens (human) ] |
Official Symbol | TFPI2 |
Synonyms | TFPI2; tissue factor pathway inhibitor 2; PP5; REF1; TFPI 2; placental protein 5; TFPI-2; FLJ21164; |
mRNA Refseq | NM_006528 |
Protein Refseq | NP_006519 |
MIM | 600033 |
UniProt ID | P48307 |
◆ Recombinant Proteins | ||
TFPI2-4641H | Recombinant Tissue Factor Pathway Inhibitor 2, His-tagged | +Inquiry |
TFPI2-5403H | Recombinant Human TFPI2 Protein (Asp23-Lys213), C-His tagged | +Inquiry |
Tfpi2-5184M | Recombinant Mouse Tfpi2 protein(Met1-Lys211), His-tagged | +Inquiry |
Tfpi2-1996M | Recombinant Mouse Tfpi2 protein, His-tagged | +Inquiry |
Tfpi2-1997R | Recombinant Rat Tfpi2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TFPI2C-65H | Recombinant Human TFPI2 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFPI2-2771HCL | Recombinant Human TFPI2 cell lysate | +Inquiry |
TFPI2-1519MCL | Recombinant Mouse TFPI2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TFPI2 Products
Required fields are marked with *
My Review for All TFPI2 Products
Required fields are marked with *
0
Inquiry Basket