Recombinant Human TG protein(1511-1610 aa), C-His-tagged
| Cat.No. : | TG-2515H |
| Product Overview : | Recombinant Human TG protein(P01266)(1511-1610 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1511-1610 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 13 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | VTDCQRNEAGLQCDQNGQYRASQKDRGSGKAFCVDGEGRRLPWWETEAPLEDSQCLMMQKFEKVPESKVIFDANAPVAVRSKVPDSEFPVMQCLTDCTED |
| Gene Name | TG thyroglobulin [ Homo sapiens ] |
| Official Symbol | TG |
| Synonyms | TG; thyroglobulin; AITD3; TGN; |
| Gene ID | 7038 |
| mRNA Refseq | NM_003235 |
| Protein Refseq | NP_003226 |
| MIM | 188450 |
| UniProt ID | P01266 |
| ◆ Recombinant Proteins | ||
| TG-8266H | Recombinant Human TG, GST-tagged | +Inquiry |
| TG-8267H | Recombinant Human TG, GST-tagged | +Inquiry |
| TG-16699M | Recombinant Mouse TG Protein | +Inquiry |
| TG-708H | Recombinant Human TG Protein, MYC/DDK-tagged | +Inquiry |
| TG-4645H | Thyroglobulin(Human) | +Inquiry |
| ◆ Native Proteins | ||
| TG-393H | Native Human Thyroglobulin | +Inquiry |
| TG-22P | Native Porcine Thyroglobulin (TG) Protein | +Inquiry |
| TG-121B | Native Bovine TG | +Inquiry |
| TG-8265H | Native Human Thyroids Thyroglobulin | +Inquiry |
| TG-31519TH | Native Human TG | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TG Products
Required fields are marked with *
My Review for All TG Products
Required fields are marked with *
