Recombinant Human THRSP protein, GST-tagged

• Cat.No.: THRSP-3223H
• Product Overview: Recombinant Human THRSP protein(1-146 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-146 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMTGQVW
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: THRSP thyroid hormone responsive [ Homo sapiens ]
• Official Symbol: THRSP
• Synonyms: THRSP; thyroid hormone responsive; lipogenic protein 1 , LPGP1, thyroid hormone responsive SPOT14 (rat) homolog; thyroid hormone-inducible hepatic protein; Lpgp; S14; SPOT14; SPOT14 homolog (rat); SPOT14 homolog; spot 14 protein; lipogenic protein 1; thyroid hormone responsive SPOT14; thyroid hormone responsive (SPOT14 homolog, rat); LPGP1; MGC21659
• Gene ID: 7069
• mRNA Refseq: NM_003251
• Protein Refseq: NP_003242
• MIM: 601926
• UniProt ID: Q92748