"THSD7A" Related Products

Recombinant Human THSD7A Protein, His-tagged

Cat.No.: THSD7A-1039H
Product Overview: Recombinant Human THSD7A Protein (48-1171) was expressed in HEK 293 cells with C-terminal His tag.
Source: HEK293
Species: Human
Tag : His
Form: PBS, 10% Glycerol.
Bio-activity: This protein has been used in quantitative ELISA to precipitate anti-THSD7A antibodies in patients with idiopathic membranous nephropathy (THSD7A positive). A publication is to follow shortly.
Molecular Mass: 127.6 kDa
AA Sequence: AAQGEAEAPTLYLWKTGPWGRCMGDECGPGGIQTRAVWCAHVEGWTTLHTNCKQAERPNNQQNCFKVCDWHKELYDWRLGPWNQCQPVISKSLEKPLECIKGEEGIQVREIACIQKDKDIPAEDIICEYFEPKPLLEQACLIPCQQDCIVSEFSAWSECSKTCGSGLQHRTRHVVAPPQFGGSGCPNLTEFQVCQSSPCEAEELRYSLHVGPWSTCSMPHSRQVRQARRRGKNKEREKDRSKGVKDPEARELIKKKRNRNRQNRQENKYWDIQIGYQTREVMCINKTGKAADLSFCQQEKLPMTFQSCVITKECQVSEWSEWSPCSKTCHDMVSPAGTRVRTRTIRQFPIGSEKECPEFEEKEPCLSQGDGVVPCATYGWRTTEWTECRVDPLLSQQDKRRGNQTALCGGGIQTREVYCVQANENLLSQLSTHKNKEASKPMDLKLCTGPIPNTTQLCHIPCPTECEVSPWSAWGPCTYENCNDQQGKKGFKLRKRRIT
NEPTGGSGVTGNCPHLLEAIPCEEPACYDWKAVRLGNCEPDNGKECGPGTQVQEVVCINSDGEEVDRQLCRD
AIFPIPVACDAPCPKDCVLSTWSTWSSCSHTCSGKTTEGKQIRARSILAYAGEEGGIRCPNSSALQEVRSCNEH
PCTVYHWQTGPWGQCIEDTSVSSFNTTTTWNGEASCSVGMQTRKVICVRVNVGQVGPKKCPESLRPETVRP
CLLPCKKDCIVTPYSDWTSCPSSCKEGDSSIRKQSRHRVIIQLPANGGRDCTDPLYEEKACEAPQACQSYRWK
THKWRRCQLVPWSVQQDSPGAQEGCGPGRQARAITCRKQDGGQAGIHECLQYAGPVPALTQACQIPCQDD
CQLTSWSKFSSCNGDCGAVRTRKRTLVGKSKKKEKCKNSHLYPLIETQYCPCDKYNAQPVGNWSDCILPEGK
VEVLLGMKVQGDIKECGQGYRYQAMACYDQNGRLVETSRCNSHGYIEEACIIPCPSDCKLSEWSNWSRCSKSC
GSGVKVRSKWLREKPYNGGRPCPKLDHVNQAQVYEVVPCHSDCNQYLWVTEPWSICKVTFVNMRENCGEG
VQTRKVRCMQNTADGPSEHVEDYLCDPEEMPLGSRVCKLPCPEDCVISEWGSGHHHHHHHHHH
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg), as measured by LAL method.
Purity: >95% as estimated by SDS-PAGE stained with Instant Blue Stain (Expedeon).
Storage: The protein should be stored at -20 centigrade to -70 centigrade preferably in small aliquots to avoid repeated freeze-thaw cycles.
Gene Name: THSD7A thrombospondin type 1 domain containing 7A [ Homo sapiens (human) ]
Official Symbol: THSD7A
Synonyms: hrombospondin, type I, domain containing 7A
Gene ID: 221981
mRNA Refseq: NM_015204.2
Protein Refseq: NP_056019.1
MIM: 612249
UniProt ID: Q9UPZ6

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.