| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
The Thy1/CD90 cell surface antigen is a GPI-anchored, developmentally regulated protein involved in signaling cascades that mediate neurite outgrowth, T cell activation, tumor suppression, apoptosis, and fibrosis. Thy1/CD90 is highly expressed on the surface of adult neurons and is thought to play a role in modulating adhesive and migratory events, such as neurite extension. Decreased Thy1/CD90 mRNA and protein expression is associated with the development of epithelial ovarian cancer, suggesting a role as a putative tumor suppressor gene of human ovarian cancer. Research studies indicate that Thy1/CD90 knockout mice have impaired cutaneous immune responses and abnormal retinal development. Thy1/CD90 is epigenetically regulated or deregulated in some disease states, such as pulmonary fibrosis. The potentially reversible hypermethylation of the Thy1/CD90 promoter offers the possibility of novel therapeutic options in this disease. |
| Molecular Mass : |
~17 kDa |
| AA Sequence : |
MQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC |
| Purity : |
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
| Notes : |
For research use only, not for use in diagnostic procedure. |
| Storage : |
Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
| Storage Buffer : |
PBS, 4M Urea, pH7.4 |
