Recombinant Human THYN1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | THYN1-2214H |
| Product Overview : | THYN1 MS Standard C13 and N15-labeled recombinant protein (NP_954994) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described. |
| Molecular Mass : | 18.8 kDa |
| AA Sequence : | MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMKSLILFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | THYN1 thymocyte nuclear protein 1 [ Homo sapiens (human) ] |
| Official Symbol | THYN1 |
| Synonyms | THYN1; thymocyte nuclear protein 1; THY28; thymocyte protein thy28; MY105; MDS012; HSPC144; THY28KD; MGC12187; |
| Gene ID | 29087 |
| mRNA Refseq | NM_199297 |
| Protein Refseq | NP_954994 |
| MIM | 613739 |
| UniProt ID | Q9P016 |
| ◆ Recombinant Proteins | ||
| THYN1-9204M | Recombinant Mouse THYN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| THYN1-6062R | Recombinant Rat THYN1 Protein | +Inquiry |
| THYN1-646H | Recombinant Human THYN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| THYN1-5719R | Recombinant Rat THYN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| THYN1-2214H | Recombinant Human THYN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| THYN1-1081HCL | Recombinant Human THYN1 293 Cell Lysate | +Inquiry |
| THYN1-1082HCL | Recombinant Human THYN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All THYN1 Products
Required fields are marked with *
My Review for All THYN1 Products
Required fields are marked with *
