Recombinant Human TIA1 protein(11-380 aa), C-His-tagged
Cat.No. : | TIA1-2720H |
Product Overview : | Recombinant Human TIA1 protein(P31483)(11-380 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 11-380 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYET |
Gene Name | TIA1 TIA1 cytotoxic granule-associated RNA binding protein [ Homo sapiens ] |
Official Symbol | TIA1 |
Synonyms | TIA1; TIA1 cytotoxic granule-associated RNA binding protein; TIA1 cytotoxic granule associated RNA binding protein; nucleolysin TIA-1 isoform p40; nucleolysin TIA 1 isoform p40; T cell restricted intracellular antigen 1; p40-TIA-1 (containing p15-TIA-1); T-cell-restricted intracellular antigen-1; TIA-1; |
Gene ID | 7072 |
mRNA Refseq | NM_022037 |
Protein Refseq | NP_071320 |
MIM | 603518 |
UniProt ID | P31483 |
◆ Recombinant Proteins | ||
TIA1-5927C | Recombinant Chicken TIA1 | +Inquiry |
TIA1-11906Z | Recombinant Zebrafish TIA1 | +Inquiry |
TIA1-763C | Recombinant Cynomolgus Monkey TIA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TIA1-2720H | Recombinant Human TIA1 protein(11-380 aa), C-His-tagged | +Inquiry |
TIA1-3229H | Recombinant Human TIA1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIA1-1778HCL | Recombinant Human TIA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TIA1 Products
Required fields are marked with *
My Review for All TIA1 Products
Required fields are marked with *