Recombinant Human TIA1 protein, His-tagged

• Cat.No.: TIA1-4722H
• Product Overview: Recombinant Human TIA1 protein(P31483)(1-386 aa), fused with C-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 1-386 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 44.4 kDa
• AASequence: MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: TIA1 TIA1 cytotoxic granule-associated RNA binding protein [ Homo sapiens ]
• Official Symbol: TIA1
• Synonyms: TIA1; TIA1 cytotoxic granule-associated RNA binding protein; TIA1 cytotoxic granule associated RNA binding protein; nucleolysin TIA-1 isoform p40; nucleolysin TIA 1 isoform p40; T cell restricted intracellular antigen 1; p40-TIA-1 (containing p15-TIA-1); T-cell-restricted intracellular antigen-1; TIA-1
• Gene ID: 7072
• mRNA Refseq: NM_022037
• Protein Refseq: NP_071320
• MIM: 603518
• UniProt ID: P31483