Recombinant Human TIA1 protein, His-tagged
| Cat.No. : | TIA1-4722H |
| Product Overview : | Recombinant Human TIA1 protein(P31483)(1-386 aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1-386 aa |
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : | 44.4 kDa |
| AASequence : | MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Gene Name | TIA1 TIA1 cytotoxic granule-associated RNA binding protein [ Homo sapiens ] |
| Official Symbol | TIA1 |
| Synonyms | TIA1; TIA1 cytotoxic granule-associated RNA binding protein; TIA1 cytotoxic granule associated RNA binding protein; nucleolysin TIA-1 isoform p40; nucleolysin TIA 1 isoform p40; T cell restricted intracellular antigen 1; p40-TIA-1 (containing p15-TIA-1); T-cell-restricted intracellular antigen-1; TIA-1; |
| Gene ID | 7072 |
| mRNA Refseq | NM_022037 |
| Protein Refseq | NP_071320 |
| MIM | 603518 |
| UniProt ID | P31483 |
| ◆ Recombinant Proteins | ||
| TIA1-763C | Recombinant Cynomolgus Monkey TIA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TIA1-11906Z | Recombinant Zebrafish TIA1 | +Inquiry |
| TIA1-5927C | Recombinant Chicken TIA1 | +Inquiry |
| TIA1-1047H | Recombinant Human TIA1 Protein, MYC/DDK-tagged | +Inquiry |
| TIA1-3545H | Recombinant Human TIA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TIA1-1778HCL | Recombinant Human TIA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TIA1 Products
Required fields are marked with *
My Review for All TIA1 Products
Required fields are marked with *
