Recombinant Human TIA1 protein, His-tagged

Cat.No. : TIA1-4722H
Product Overview : Recombinant Human TIA1 protein(P31483)(1-386 aa), fused with C-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 1-386 aa
Form : For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
Molecular Mass : 44.4 kDa
AASequence : MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Gene Name TIA1 TIA1 cytotoxic granule-associated RNA binding protein [ Homo sapiens ]
Official Symbol TIA1
Synonyms TIA1; TIA1 cytotoxic granule-associated RNA binding protein; TIA1 cytotoxic granule associated RNA binding protein; nucleolysin TIA-1 isoform p40; nucleolysin TIA 1 isoform p40; T cell restricted intracellular antigen 1; p40-TIA-1 (containing p15-TIA-1); T-cell-restricted intracellular antigen-1; TIA-1;
Gene ID 7072
mRNA Refseq NM_022037
Protein Refseq NP_071320
MIM 603518
UniProt ID P31483

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TIA1 Products

Required fields are marked with *

My Review for All TIA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon