Recombinant Human TIA1 protein, His-tagged
| Cat.No. : | TIA1-3208H |
| Product Overview : | Recombinant Human TIA1 protein(1-214 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 29, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-214 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYECRCIGEEKEMWNFGEKYARF |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | TIA1 TIA1 cytotoxic granule-associated RNA binding protein [ Homo sapiens ] |
| Official Symbol | TIA1 |
| Synonyms | TIA1; TIA1 cytotoxic granule-associated RNA binding protein; TIA1 cytotoxic granule associated RNA binding protein; nucleolysin TIA-1 isoform p40; nucleolysin TIA 1 isoform p40; T cell restricted intracellular antigen 1; p40-TIA-1 (containing p15-TIA-1); T-cell-restricted intracellular antigen-1; TIA-1; |
| Gene ID | 7072 |
| mRNA Refseq | NM_022037 |
| Protein Refseq | NP_071320 |
| MIM | 603518 |
| UniProt ID | P31483 |
| ◆ Recombinant Proteins | ||
| Tia1-6423M | Recombinant Mouse Tia1 Protein, Myc/DDK-tagged | +Inquiry |
| TIA1-133HFL | Recombinant Full Length Human TIA1 Protein, C-Flag-tagged | +Inquiry |
| TIA1-4597C | Recombinant Chicken TIA1 | +Inquiry |
| TIA1-2192H | Recombinant Human TIA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TIA1-3229H | Recombinant Human TIA1, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TIA1-1778HCL | Recombinant Human TIA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TIA1 Products
Required fields are marked with *
My Review for All TIA1 Products
Required fields are marked with *
