Recombinant Human TIA1 protein, His-tagged
Cat.No. : | TIA1-3208H |
Product Overview : | Recombinant Human TIA1 protein(1-214 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-214 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYECRCIGEEKEMWNFGEKYARF |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TIA1 TIA1 cytotoxic granule-associated RNA binding protein [ Homo sapiens ] |
Official Symbol | TIA1 |
Synonyms | TIA1; TIA1 cytotoxic granule-associated RNA binding protein; TIA1 cytotoxic granule associated RNA binding protein; nucleolysin TIA-1 isoform p40; nucleolysin TIA 1 isoform p40; T cell restricted intracellular antigen 1; p40-TIA-1 (containing p15-TIA-1); T-cell-restricted intracellular antigen-1; TIA-1; |
Gene ID | 7072 |
mRNA Refseq | NM_022037 |
Protein Refseq | NP_071320 |
MIM | 603518 |
UniProt ID | P31483 |
◆ Recombinant Proteins | ||
TIA1-3208H | Recombinant Human TIA1 protein, His-tagged | +Inquiry |
TIA1-4597C | Recombinant Chicken TIA1 | +Inquiry |
TIA1-133HFL | Recombinant Full Length Human TIA1 Protein, C-Flag-tagged | +Inquiry |
TIA1-2720H | Recombinant Human TIA1 protein(11-380 aa), C-His-tagged | +Inquiry |
TIA1-1047H | Recombinant Human TIA1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIA1-1778HCL | Recombinant Human TIA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TIA1 Products
Required fields are marked with *
My Review for All TIA1 Products
Required fields are marked with *
0
Inquiry Basket