Recombinant Human TIAM1 protein, GST-tagged

Cat.No. : TIAM1-301503H
Product Overview : Recombinant Human TIAM1 (823-1002 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met823-Val1002
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MQPEEDIYELLYKEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVELLESPPHRVDGPADLGESPLAFLTSNPGHSLCSEQGSSAETAPEETEGPDLESSDETDHSSKSTEQV
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name TIAM1 T-cell lymphoma invasion and metastasis 1 [ Homo sapiens ]
Official Symbol TIAM1
Synonyms TIAM1; T-cell lymphoma invasion and metastasis 1; T-lymphoma invasion and metastasis-inducing protein 1; TIAM-1; human T-lymphoma invasion and metastasis inducing TIAM1 protein; FLJ36302;
Gene ID 7074
mRNA Refseq NM_003253
Protein Refseq NP_003244
MIM 600687
UniProt ID Q13009

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TIAM1 Products

Required fields are marked with *

My Review for All TIAM1 Products

Required fields are marked with *

0
cart-icon
0
compare icon