Recombinant Human TIAM1 protein, GST-tagged
Cat.No. : | TIAM1-301503H |
Product Overview : | Recombinant Human TIAM1 (823-1002 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met823-Val1002 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MQPEEDIYELLYKEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVELLESPPHRVDGPADLGESPLAFLTSNPGHSLCSEQGSSAETAPEETEGPDLESSDETDHSSKSTEQV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | TIAM1 T-cell lymphoma invasion and metastasis 1 [ Homo sapiens ] |
Official Symbol | TIAM1 |
Synonyms | TIAM1; T-cell lymphoma invasion and metastasis 1; T-lymphoma invasion and metastasis-inducing protein 1; TIAM-1; human T-lymphoma invasion and metastasis inducing TIAM1 protein; FLJ36302; |
Gene ID | 7074 |
mRNA Refseq | NM_003253 |
Protein Refseq | NP_003244 |
MIM | 600687 |
UniProt ID | Q13009 |
◆ Recombinant Proteins | ||
TIAM1-634H | Recombinant Human TIAM1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TIAM1-8065H | Recombinant Human TIAM1 protein, His & T7-tagged | +Inquiry |
Tiam1-6424M | Recombinant Mouse Tiam1 Protein, Myc/DDK-tagged | +Inquiry |
TIAM1-4711R | Recombinant Rhesus monkey TIAM1 Protein, His-tagged | +Inquiry |
TIAM1-6451H | Recombinant Human TIAM1 Protein (Val550-Lys1040), N-GST tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TIAM1 Products
Required fields are marked with *
My Review for All TIAM1 Products
Required fields are marked with *
0
Inquiry Basket