Recombinant Human TICAM1 protein, GST-tagged
Cat.No. : | TICAM1-301439H |
Product Overview : | Recombinant Human TICAM1 (1-143 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Arg143 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MACTGPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARISLEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVAYQEAVRTLSSRDDHRLGELQDEARNR |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | TICAM1 toll-like receptor adaptor molecule 1 [ Homo sapiens ] |
Official Symbol | TICAM1 |
Synonyms | TICAM1; toll-like receptor adaptor molecule 1; TIR domain-containing adapter molecule 1; MGC35334; PRVTIRB; TICAM 1; TRIF; putative NF-kappa-B-activating protein 502H; TIR domain containing adaptor inducing interferon-beta; TIR domain-containing adapter protein inducing IFN-beta; proline-rich, vinculin and TIR domain-containing protein B; toll-interleukin-1 receptor domain-containing adapter protein inducing interferon beta; TICAM-1; |
Gene ID | 148022 |
mRNA Refseq | NM_182919 |
Protein Refseq | NP_891549 |
MIM | 607601 |
UniProt ID | Q8IUC6 |
◆ Recombinant Proteins | ||
TICAM1-3657C | Recombinant Chicken TICAM1 | +Inquiry |
TICAM1-16772M | Recombinant Mouse TICAM1 Protein | +Inquiry |
Ticam1-649M | Recombinant Mouse Ticam1 Protein, His-tagged | +Inquiry |
TICAM1-2447H | Recombinant Human TICAM1 protein | +Inquiry |
TICAM1-4712R | Recombinant Rhesus monkey TICAM1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TICAM1-1080HCL | Recombinant Human TICAM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TICAM1 Products
Required fields are marked with *
My Review for All TICAM1 Products
Required fields are marked with *
0
Inquiry Basket