Recombinant Human TICAM1 protein, GST-tagged

Cat.No. : TICAM1-301439H
Product Overview : Recombinant Human TICAM1 (1-143 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Arg143
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MACTGPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARISLEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVAYQEAVRTLSSRDDHRLGELQDEARNR
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name TICAM1 toll-like receptor adaptor molecule 1 [ Homo sapiens ]
Official Symbol TICAM1
Synonyms TICAM1; toll-like receptor adaptor molecule 1; TIR domain-containing adapter molecule 1; MGC35334; PRVTIRB; TICAM 1; TRIF; putative NF-kappa-B-activating protein 502H; TIR domain containing adaptor inducing interferon-beta; TIR domain-containing adapter protein inducing IFN-beta; proline-rich, vinculin and TIR domain-containing protein B; toll-interleukin-1 receptor domain-containing adapter protein inducing interferon beta; TICAM-1;
Gene ID 148022
mRNA Refseq NM_182919
Protein Refseq NP_891549
MIM 607601
UniProt ID Q8IUC6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TICAM1 Products

Required fields are marked with *

My Review for All TICAM1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon