Recombinant Human TIFA protein, His-tagged
Cat.No. : | TIFA-2322H |
Product Overview : | Recombinant Human TIFA protein(38-134 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 38-134 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | REKLPSSEVVKFGRNSNICHYTFQDKQVSRVQFSLQLFKKFNSSVLSFEIKNMSKKTNLIVDSRELGYLNKMDLPYRCMVRFGEYQFLMEKEDGESL |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | TIFA TRAF-interacting protein with forkhead-associated domain [ Homo sapiens ] |
Official Symbol | TIFA |
Synonyms | TIFA; TRAF-interacting protein with forkhead-associated domain; TRAF-interacting protein with FHA domain-containing protein A; MGC20791; T2BP; T6BP; TIFAA; TRAF2 binding protein; TRAF6 binding protein; TRAF2-binding protein; putative MAPK-activating protein PM14; putative NF-kappa-B-activating protein 20; TRAF-interacting protein with a forkhead-associated domain; |
mRNA Refseq | NM_052864 |
Protein Refseq | NP_443096 |
MIM | 609028 |
UniProt ID | Q96CG3 |
Gene ID | 92610 |
◆ Recombinant Proteins | ||
TIFA-6063R | Recombinant Rat TIFA Protein | +Inquiry |
TIFA-2322H | Recombinant Human TIFA protein, His-tagged | +Inquiry |
TIFA-3231H | Recombinant Human TIFA protein, GST-tagged | +Inquiry |
TIFA-4714R | Recombinant Rhesus monkey TIFA Protein, His-tagged | +Inquiry |
TIFA-5552H | Recombinant Human TRAF-Interacting Protein With Forkhead-Associated Domain, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIFA-1078HCL | Recombinant Human TIFA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TIFA Products
Required fields are marked with *
My Review for All TIFA Products
Required fields are marked with *
0
Inquiry Basket