Recombinant Human TIFA protein, His-tagged

Cat.No. : TIFA-2322H
Product Overview : Recombinant Human TIFA protein(38-134 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : His
Protein Length : 38-134 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : REKLPSSEVVKFGRNSNICHYTFQDKQVSRVQFSLQLFKKFNSSVLSFEIKNMSKKTNLIVDSRELGYLNKMDLPYRCMVRFGEYQFLMEKEDGESL
Purity : 85%, by SDS-PAGE.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name TIFA TRAF-interacting protein with forkhead-associated domain [ Homo sapiens ]
Official Symbol TIFA
Synonyms TIFA; TRAF-interacting protein with forkhead-associated domain; TRAF-interacting protein with FHA domain-containing protein A; MGC20791; T2BP; T6BP; TIFAA; TRAF2 binding protein; TRAF6 binding protein; TRAF2-binding protein; putative MAPK-activating protein PM14; putative NF-kappa-B-activating protein 20; TRAF-interacting protein with a forkhead-associated domain;
mRNA Refseq NM_052864
Protein Refseq NP_443096
MIM 609028
UniProt ID Q96CG3
Gene ID 92610

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TIFA Products

Required fields are marked with *

My Review for All TIFA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon