Recombinant Human TIMM17A Protein (1-171 aa), GST-tagged
Cat.No. : | TIMM17A-2130H |
Product Overview : | Recombinant Human TIMM17A Protein (1-171 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-171 aa |
Description : | Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 45.0 kDa |
AA Sequence : | MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | TIMM17A translocase of inner mitochondrial membrane 17 homolog A (yeast) [ Homo sapiens ] |
Official Symbol | TIMM17A |
Synonyms | TIM17; TIM17A; |
Gene ID | 10440 |
mRNA Refseq | NM_006335.2 |
Protein Refseq | NP_006326.1 |
MIM | 605057 |
UniProt ID | Q99595 |
◆ Cell & Tissue Lysates | ||
TIMM17A-1070HCL | Recombinant Human TIMM17A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TIMM17A Products
Required fields are marked with *
My Review for All TIMM17A Products
Required fields are marked with *
0
Inquiry Basket