Recombinant Human TIMM17A Protein (1-171 aa), GST-tagged

Cat.No. : TIMM17A-2130H
Product Overview : Recombinant Human TIMM17A Protein (1-171 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-171 aa
Description : Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 45.0 kDa
AA Sequence : MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name TIMM17A translocase of inner mitochondrial membrane 17 homolog A (yeast) [ Homo sapiens ]
Official Symbol TIMM17A
Synonyms TIM17; TIM17A;
Gene ID 10440
mRNA Refseq NM_006335.2
Protein Refseq NP_006326.1
MIM 605057
UniProt ID Q99595

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TIMM17A Products

Required fields are marked with *

My Review for All TIMM17A Products

Required fields are marked with *

0
cart-icon
0
compare icon