Recombinant Human TIMM17A Protein (1-171 aa), GST-tagged

• Cat.No.: TIMM17A-2130H
• Product Overview: Recombinant Human TIMM17A Protein (1-171 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-171 aa
• Description: Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 45.0 kDa
• AA Sequence: MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: TIMM17A translocase of inner mitochondrial membrane 17 homolog A (yeast) [ Homo sapiens ]
• Official Symbol: TIMM17A
• Synonyms: TIM17; TIM17A
• Gene ID: 10440
• mRNA Refseq: NM_006335.2
• Protein Refseq: NP_006326.1
• MIM: 605057
• UniProt ID: Q99595