Recombinant Human TIMM44 protein, GST-tagged
| Cat.No. : | TIMM44-3618H |
| Product Overview : | Recombinant Human TIMM44 protein(153-452 aa), fused to GST tag, was expressed in E. coli. |
| Availability | December 21, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 153-452 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | AKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKFKEEKVFEPNEEALGVVLHKDSKWYQQWKDFKENNVVFNRFFEMKMKYDESDNAFIRASRALTDKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILKDWCYEATYSQLAHPIQQAKALGLQFHSRILDIDNVDLAMGKMMEQGPVLIITFQAQLVMVVRNPKGEVVEGDPDKVLRMLYVWALCRDQDELNPYAAWRLLDISASSTEQIL |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | TIMM44 translocase of inner mitochondrial membrane 44 homolog (yeast) [ Homo sapiens ] |
| Official Symbol | TIMM44 |
| Synonyms | TIMM44; translocase of inner mitochondrial membrane 44 homolog (yeast); mitochondrial import inner membrane translocase subunit TIM44; TIM44; mitochondrial inner membrane translocase; DKFZp686H05241; |
| Gene ID | 10469 |
| mRNA Refseq | NM_006351 |
| Protein Refseq | NP_006342 |
| MIM | 605058 |
| UniProt ID | O43615 |
| ◆ Recombinant Proteins | ||
| TIMM44-2177Z | Recombinant Zebrafish TIMM44 | +Inquiry |
| TIMM44-5729R | Recombinant Rat TIMM44 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TIMM44-3237H | Recombinant Human TIMM44, GST-tagged | +Inquiry |
| TIMM44-3618H | Recombinant Human TIMM44 protein, GST-tagged | +Inquiry |
| TIMM44-16791M | Recombinant Mouse TIMM44 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TIMM44-1781HCL | Recombinant Human TIMM44 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TIMM44 Products
Required fields are marked with *
My Review for All TIMM44 Products
Required fields are marked with *
