Recombinant Human TLR3 Protein(26-348 aa), His-tagged
Cat.No. : | TLR3-071H |
Product Overview : | Recombinant Human TLR3 Protein(26-348 aa), fused with His tag, was expressed in E. coli. |
Availability | June 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 26-348 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MRQTLPCIYFWGGLLPFGMLCASSTTKCTVSHEVADCSHLKLTQVPDDLPTNITVLNLTHNQLRRLPAANFTRYSQLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFAFCTNLTELHLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFGLFLNNVQLGPSLTEKLCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPQLEYFFLEYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQSISLASLPKIDD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
Gene Name | TLR3 toll-like receptor 3 [ Homo sapiens ] |
Official Symbol | TLR3 |
Synonyms | TLR3; toll-like receptor 3; CD283; IIAE2; |
Gene ID | 7098 |
mRNA Refseq | NM_003265 |
Protein Refseq | NP_003256 |
MIM | 603029 |
UniProt ID | O15455 |
◆ Recombinant Proteins | ||
Tlr3-2072M | Recombinant Mouse Tlr3 protein, His-tagged | +Inquiry |
TLR3-1672R | Recombinant Rhesus Monkey TLR3 Protein, hIgG4-tagged | +Inquiry |
TLR3-2076Z | Recombinant Zebrafish TLR3 | +Inquiry |
TLR3-0788M | Recombinant Mouse TLR3 protein, Fc-tagged | +Inquiry |
Tlr3-2073M | Recombinant Mouse Tlr3 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TLR3-642MCL | Recombinant Mouse TLR3 cell lysate | +Inquiry |
TLR3-2447MCL | Recombinant Mouse TLR3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TLR3 Products
Required fields are marked with *
My Review for All TLR3 Products
Required fields are marked with *