Recombinant Human TM2D1 Protein, GST-tagged

Species :	Human
Source :	Wheat Germ
Tag :	GST
Description :	The protein encoded by this gene is a beta-amyloid peptide-binding protein. It contains a structural module related to that of the seven transmembrane domain G protein-coupled receptor superfamily and known to be important in heterotrimeric G protein activation. Beta-amyloid peptide has been established to be a causative factor in neuron death and the consequent diminution of cognitive abilities observed in Alzheimers disease. This protein may be a target of neurotoxic beta-amyloid peptide, and may mediate cellular vulnerability to beta-amyloid peptide toxicity through a G protein-regulated program of cell death.
Form :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass :	44.88 kDa
AA Sequence :	WGAVATSAGGEESLKCEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVNGYSYKVAVALSLFLGWLGADRFYLGYPALGLLKFCTVGFCGIGSLIDFILISMQIVGPSDGSSYIIDYYGTRLTRLSITNETFRKTQLYP
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	TM2D1 TM2 domain containing 1 [ Homo sapiens ]
Official Symbol	TM2D1
Synonyms	TM2D1; TM2 domain containing 1; TM2 domain-containing protein 1; BBP; hBBP; beta-amyloid-binding protein;
Gene ID	83941
mRNA Refseq	NM_032027
Protein Refseq	NP_114416
MIM	610080
UniProt ID	Q9BX74