Recombinant Human TM2D1 Protein, GST-tagged
| Cat.No. : | TM2D1-103H |
| Product Overview : | Human BBP full-length ORF ( AAH29486.1, 33 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a beta-amyloid peptide-binding protein. It contains a structural module related to that of the seven transmembrane domain G protein-coupled receptor superfamily and known to be important in heterotrimeric G protein activation. Beta-amyloid peptide has been established to be a causative factor in neuron death and the consequent diminution of cognitive abilities observed in Alzheimers disease. This protein may be a target of neurotoxic beta-amyloid peptide, and may mediate cellular vulnerability to beta-amyloid peptide toxicity through a G protein-regulated program of cell death. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 44.88 kDa |
| AA Sequence : | WGAVATSAGGEESLKCEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVNGYSYKVAVALSLFLGWLGADRFYLGYPALGLLKFCTVGFCGIGSLIDFILISMQIVGPSDGSSYIIDYYGTRLTRLSITNETFRKTQLYP |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | TM2D1 TM2 domain containing 1 [ Homo sapiens ] |
| Official Symbol | TM2D1 |
| Synonyms | TM2D1; TM2 domain containing 1; TM2 domain-containing protein 1; BBP; hBBP; beta-amyloid-binding protein; |
| Gene ID | 83941 |
| mRNA Refseq | NM_032027 |
| Protein Refseq | NP_114416 |
| MIM | 610080 |
| UniProt ID | Q9BX74 |
| ◆ Recombinant Proteins | ||
| TM2D1-9242M | Recombinant Mouse TM2D1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL19335MF | Recombinant Full Length Mouse Tm2 Domain-Containing Protein 1(Tm2D1) Protein, His-Tagged | +Inquiry |
| RFL24295HF | Recombinant Full Length Human Tm2 Domain-Containing Protein 1(Tm2D1) Protein, His-Tagged | +Inquiry |
| TM2D1-103H | Recombinant Human TM2D1 Protein, GST-tagged | +Inquiry |
| TM2D1-16835M | Recombinant Mouse TM2D1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TM2D1-1039HCL | Recombinant Human TM2D1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TM2D1 Products
Required fields are marked with *
My Review for All TM2D1 Products
Required fields are marked with *
