Recombinant Human TMA7 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TMA7-1585H
Product Overview : CCDC72 MS Standard C13 and N15-labeled recombinant protein (NP_057017) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : TMA7 (Translation Machinery Associated 7 Homolog) is a Protein Coding gene. An important paralog of this gene is ENSG00000225528.
Molecular Mass : 7.1 kDa
AA Sequence : MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKGPLATGGIKKSGKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TMA7 translation machinery associated 7 homolog [ Homo sapiens (human) ]
Official Symbol TMA7
Synonyms CCDC72; HSPC016; translation machinery-associated protein 7; coiled-coil domain containing 72; coiled-coil domain-containing protein 72; translational machinery associated 7 homolog; TMA7
Gene ID 51372
mRNA Refseq NM_015933
Protein Refseq NP_057017
MIM 615808
UniProt ID Q9Y2S6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMA7 Products

Required fields are marked with *

My Review for All TMA7 Products

Required fields are marked with *

0
cart-icon
0
compare icon