Recombinant Human TMED9 Protein (40-197 aa), GST-tagged
Cat.No. : | TMED9-1208H |
Product Overview : | Recombinant Human TMED9 Protein (40-197 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 40-197 aa |
Description : | Appears to be involved in vesicular protein trafficking, mainly in the early secretory pathway. In COPI vesicle-mediated retrograde transport involved in the coatomer recruitment to mbranes of the early secretory pathway. Increases coatomer-dependent activity of ARFGAP2. Thought to play a crucial role in the specific retention of p24 complexes in cis-Golgi mbranes; specifically contributes to the coupled localization of TMED2 and TMED10 in the cis-Golgi network. May be involved in organization of intracellular mbranes, such as of the ER-Golgi intermediate compartment and the Golgi apparatus. Involved in ER localization of PTPN2 isoform PTPB. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 45.5 kDa |
AA Sequence : | FHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | TMED9 transmembrane p24 trafficking protein 9 [ Homo sapiens (human) ] |
Official Symbol | TMED9 |
Synonyms | p25; GMP25; p24a2; HSGP25L2G; p24alpha2; |
Gene ID | 54732 |
mRNA Refseq | NM_017510 |
Protein Refseq | NP_059980 |
UniProt ID | Q9BVK6 |
◆ Recombinant Proteins | ||
TMED9-4570R | Recombinant Rhesus Macaque TMED9 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMED9-1208H | Recombinant Human TMED9 Protein (40-197 aa), GST-tagged | +Inquiry |
TMED9-643H | Recombinant Human TMED9 Protein, His-tagged | +Inquiry |
Tmed9-6464M | Recombinant Mouse Tmed9 Protein, Myc/DDK-tagged | +Inquiry |
TMED9-642H | Recombinant Human TMED9 Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMED9-1021HCL | Recombinant Human TMED9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMED9 Products
Required fields are marked with *
My Review for All TMED9 Products
Required fields are marked with *
0
Inquiry Basket