Recombinant Human TMEM120B protein, His-tagged
| Cat.No. : | TMEM120B-171H |
| Product Overview : | Recombinant Human TMEM120B protein(NP_001074294.2)(1 - 83 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1 - 83 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MSGQLERCEREWHELEGEFQELQETHRIYKQKLEELAALQTLCSSSISKQKKHLKDLKLTLQRCKRHASREEAELVQQMAANI |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
| Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | TMEM120B transmembrane protein 120B [ Homo sapiens ] |
| Official Symbol | TMEM120B |
| Gene ID | 144404 |
| mRNA Refseq | NM_001080825.2 |
| Protein Refseq | NP_001074294.2 |
| UniProt ID | A0PK00 |
| ◆ Recombinant Proteins | ||
| TMEM120B-2365C | Recombinant Chicken TMEM120B | +Inquiry |
| TMEM120B-4197H | Recombinant Human TMEM120B Protein, His (Fc)-Avi-tagged | +Inquiry |
| TMEM120B-1779H | Recombinant Human TMEM120B | +Inquiry |
| RFL4361XF | Recombinant Full Length Xenopus Tropicalis Transmembrane Protein 120B(Tmem120B) Protein, His-Tagged | +Inquiry |
| TMEM120B-171H | Recombinant Human TMEM120B protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TMEM120B-1010HCL | Recombinant Human TMEM120B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM120B Products
Required fields are marked with *
My Review for All TMEM120B Products
Required fields are marked with *
