Recombinant Human TMEM138 Protein, GST-tagged
| Cat.No. : | TMEM138-5265H |
| Product Overview : | Human HSPC196 full-length ORF ( AAH05201, 1 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a multi-pass transmembrane protein. Reduced expression of this gene in mouse fibroblasts causes short cilia and failure of ciliogenesis. Expression of this gene is tightly coordinated with expression of the neighboring gene TMEM216. Mutations in this gene are associated with the autosomal recessive neurodevelopmental disorder Joubert Syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2012] |
| Molecular Mass : | 43.56 kDa |
| AA Sequence : | MLQTSNYSLVLSLQFLLLSYDLFVNSFSELLQKTPVIQLVLFIIQDIAVLFNIIIIFLMFFNTFVFQAGLVNLLFHKFKGTIILTAVYFALSISLHVWVMNLRWKNSNSFIWTDGLQMLFVFQRLAAVLYCYFYKRTAVRLGDPHFYQDSLWLRKEFMQVRR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | TMEM138 transmembrane protein 138 [ Homo sapiens ] |
| Official Symbol | TMEM138 |
| Synonyms | TMEM138; transmembrane protein 138; HSPC196; |
| Gene ID | 51524 |
| mRNA Refseq | NM_016464 |
| Protein Refseq | NP_057548 |
| MIM | 614459 |
| UniProt ID | Q9NPI0 |
| ◆ Recombinant Proteins | ||
| TMEM138-6120R | Recombinant Rat TMEM138 Protein | +Inquiry |
| TMEM138-9298M | Recombinant Mouse TMEM138 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL12478DF | Recombinant Full Length Danio Rerio Transmembrane Protein 138(Tmem138) Protein, His-Tagged | +Inquiry |
| TMEM138-5232C | Recombinant Chicken TMEM138 | +Inquiry |
| TMEM138-5660HF | Recombinant Full Length Human TMEM138 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TMEM138-1002HCL | Recombinant Human TMEM138 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM138 Products
Required fields are marked with *
My Review for All TMEM138 Products
Required fields are marked with *
