Recombinant Human TMEM17 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TMEM17-6091H
• Product Overview: TMEM17 MS Standard C13 and N15-labeled recombinant protein (NP_938017) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: TMEM17 (Transmembrane Protein 17) is a Protein Coding gene. Diseases associated with TMEM17 include Orofaciodigital Syndrome I and Joubert Syndrome 14. An important paralog of this gene is TMEM80.
• Molecular Mass: 23.1 kDa
• AA Sequence: MELPDPVRQRLGNFSRAVFSDSNRTSPESNEGPENEMVSSLALQMSLYFNTYYFPLWWVSSIMMLHMKYSILPDYYKFIVITVIILITLIEAIRLYLGYVGNLQEKVPELAGFWLLSLLLQLPLILFLLFNEGLTNLPLEKAIHIIFTLFLAFQVVAAFLTLRKMVNQLAVRFHLQDFDRLSANRGDMRRMRSCIEEITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TMEM17 transmembrane protein 17 [ Homo sapiens (human) ]
• Official Symbol: TMEM17
• Synonyms: TMEM17; transmembrane protein 17; FLJ34583
• Gene ID: 200728
• mRNA Refseq: NM_198276
• Protein Refseq: NP_938017
• MIM: 614950
• UniProt ID: Q86X19