Recombinant Human TMEM17 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TMEM17-6091H
Product Overview : TMEM17 MS Standard C13 and N15-labeled recombinant protein (NP_938017) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : TMEM17 (Transmembrane Protein 17) is a Protein Coding gene. Diseases associated with TMEM17 include Orofaciodigital Syndrome I and Joubert Syndrome 14. An important paralog of this gene is TMEM80.
Molecular Mass : 23.1 kDa
AA Sequence : MELPDPVRQRLGNFSRAVFSDSNRTSPESNEGPENEMVSSLALQMSLYFNTYYFPLWWVSSIMMLHMKYSILPDYYKFIVITVIILITLIEAIRLYLGYVGNLQEKVPELAGFWLLSLLLQLPLILFLLFNEGLTNLPLEKAIHIIFTLFLAFQVVAAFLTLRKMVNQLAVRFHLQDFDRLSANRGDMRRMRSCIEEITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TMEM17 transmembrane protein 17 [ Homo sapiens (human) ]
Official Symbol TMEM17
Synonyms TMEM17; transmembrane protein 17; FLJ34583;
Gene ID 200728
mRNA Refseq NM_198276
Protein Refseq NP_938017
MIM 614950
UniProt ID Q86X19

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMEM17 Products

Required fields are marked with *

My Review for All TMEM17 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon