Recombinant Human TMEM25 Protein (27-322 aa), His-SUMO-tagged

Cat.No. : TMEM25-837H
Product Overview : Recombinant Human TMEM25 Protein (27-322 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 27-322 aa
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 48.2 kDa
AA Sequence : ELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAPGPSRHPSLISSDSNNLKLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSQGFIRLPVLGYIYRVSSVSSDEIWL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name TMEM25 transmembrane protein 25 [ Homo sapiens (human) ]
Official Symbol TMEM25
Synonyms TMEM25; transmembrane protein 25; 0610039J01Rik
Gene ID 84866
mRNA Refseq NM_001144034
Protein Refseq NP_001137506
MIM 613934
UniProt ID Q86YD3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMEM25 Products

Required fields are marked with *

My Review for All TMEM25 Products

Required fields are marked with *

0
cart-icon
0
compare icon