Recombinant Human TMEM25 Protein (27-322 aa), His-SUMO-tagged
Cat.No. : | TMEM25-837H |
Product Overview : | Recombinant Human TMEM25 Protein (27-322 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 27-322 aa |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 48.2 kDa |
AA Sequence : | ELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAPGPSRHPSLISSDSNNLKLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSQGFIRLPVLGYIYRVSSVSSDEIWL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | TMEM25 transmembrane protein 25 [ Homo sapiens (human) ] |
Official Symbol | TMEM25 |
Synonyms | TMEM25; transmembrane protein 25; 0610039J01Rik |
Gene ID | 84866 |
mRNA Refseq | NM_001144034 |
Protein Refseq | NP_001137506 |
MIM | 613934 |
UniProt ID | Q86YD3 |
◆ Recombinant Proteins | ||
TMEM25-541H | Recombinant Human TMEM25, His tagged | +Inquiry |
TMEM25-17024M | Recombinant Mouse TMEM25 Protein | +Inquiry |
TMEM25-9383M | Recombinant Mouse TMEM25 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM25-1229HFL | Recombinant Full Length Human TMEM25 Protein, C-Flag-tagged | +Inquiry |
TMEM25-2209H | Recombinant Human TMEM25 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM25-1125HCL | Recombinant Human TMEM25 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM25 Products
Required fields are marked with *
My Review for All TMEM25 Products
Required fields are marked with *
0
Inquiry Basket