Recombinant Human TMEM57 protein, His-tagged
Cat.No. : | TMEM57-3675H |
Product Overview : | Recombinant Human TMEM57 protein(497-664 aa), fused to His tag, was expressed in E. coli. |
Availability | July 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 497-664 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | ASRGECTETLRNRIRELEAEGKKLTMDMKVKEDQIRELELKVQELRKYKENEKDTEVLMSALSAMQDKTQHLENSLSAETRIKLDLFSALGDAKRQLEIAQGQILQKDQEIKDLKQKIAEVMAVMPSITYSAATSPLSPVSPHYSSKFVETSPSGLDPNASVYQPLKK |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TMEM57 transmembrane protein 57 [ Homo sapiens ] |
Official Symbol | TMEM57 |
Synonyms | TMEM57; transmembrane protein 57; macoilin; FLJ10747; MACOILIN; RP3-469D22.2; FLJ23007; |
Gene ID | 55219 |
mRNA Refseq | NM_018202 |
Protein Refseq | NP_060672 |
MIM | 610301 |
UniProt ID | Q8N5G2 |
◆ Recombinant Proteins | ||
TMEM57-3675H | Recombinant Human TMEM57 protein, His-tagged | +Inquiry |
TMEM57-5833R | Recombinant Rat TMEM57 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM57-2584C | Recombinant Chicken TMEM57 | +Inquiry |
TMEM57-4834R | Recombinant Rhesus monkey TMEM57 Protein, His-tagged | +Inquiry |
TMEM57-4648R | Recombinant Rhesus Macaque TMEM57 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM57-940HCL | Recombinant Human TMEM57 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM57 Products
Required fields are marked with *
My Review for All TMEM57 Products
Required fields are marked with *