Recombinant Human TMEM70 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TMEM70-5761H |
Product Overview : | TMEM70 MS Standard C13 and N15-labeled recombinant protein (NP_060336) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene likely encodes a mitochondrial membrane protein. The encoded protein may play a role in biogenesis of mitochondrial ATP synthase. Mutations in this gene have been associated with neonatal mitochondrial encephalocardiomyopathy due to ATP synthase deficiency. Alternatively spliced transcript variants have been described. |
Molecular Mass : | 29 kDa |
AA Sequence : | MLFLALGSPWAVELPLCGRRTALCAAAALRGPRASVSRASSSSGPSGPVAGWSTGPSGAARLLRRPGRAQIPVYWEGYVRFLNTPSDKSEDGRLIYTGNMARAVFGVKCFSYSTSLIGLTFLPYIFTQNNAISESVPLPIQIIFYGIMGSFTVITPVLLHFITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVKIPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TMEM70 transmembrane protein 70 [ Homo sapiens (human) ] |
Official Symbol | TMEM70 |
Synonyms | TMEM70; transmembrane protein 70; MC5DN2; transmembrane protein 70, mitochondrial |
Gene ID | 54968 |
mRNA Refseq | NM_017866 |
Protein Refseq | NP_060336 |
MIM | 612418 |
UniProt ID | Q9BUB7 |
◆ Recombinant Proteins | ||
RFL20901GF | Recombinant Full Length Chicken Transmembrane Protein 70, Mitochondrial(Tmem70) Protein, His-Tagged | +Inquiry |
TMEM70-4652R | Recombinant Rhesus Macaque TMEM70 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM70-2071C | Recombinant Chicken TMEM70 | +Inquiry |
TMEM70-17075M | Recombinant Mouse TMEM70 Protein | +Inquiry |
Tmem70-6513M | Recombinant Mouse Tmem70 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM70-935HCL | Recombinant Human TMEM70 293 Cell Lysate | +Inquiry |
TMEM70-934HCL | Recombinant Human TMEM70 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM70 Products
Required fields are marked with *
My Review for All TMEM70 Products
Required fields are marked with *
0
Inquiry Basket