Recombinant Human TMEM70 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | TMEM70-5761H |
| Product Overview : | TMEM70 MS Standard C13 and N15-labeled recombinant protein (NP_060336) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene likely encodes a mitochondrial membrane protein. The encoded protein may play a role in biogenesis of mitochondrial ATP synthase. Mutations in this gene have been associated with neonatal mitochondrial encephalocardiomyopathy due to ATP synthase deficiency. Alternatively spliced transcript variants have been described. |
| Molecular Mass : | 29 kDa |
| AA Sequence : | MLFLALGSPWAVELPLCGRRTALCAAAALRGPRASVSRASSSSGPSGPVAGWSTGPSGAARLLRRPGRAQIPVYWEGYVRFLNTPSDKSEDGRLIYTGNMARAVFGVKCFSYSTSLIGLTFLPYIFTQNNAISESVPLPIQIIFYGIMGSFTVITPVLLHFITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVKIPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | TMEM70 transmembrane protein 70 [ Homo sapiens (human) ] |
| Official Symbol | TMEM70 |
| Synonyms | TMEM70; transmembrane protein 70; MC5DN2; transmembrane protein 70, mitochondrial |
| Gene ID | 54968 |
| mRNA Refseq | NM_017866 |
| Protein Refseq | NP_060336 |
| MIM | 612418 |
| UniProt ID | Q9BUB7 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM70 Products
Required fields are marked with *
My Review for All TMEM70 Products
Required fields are marked with *
