| Species : | Human | 
                                
                                    | Source : | HEK293 | 
                                
                                    | Tag : | DDK&Myc | 
                                
                                    | Description : | This gene likely encodes a mitochondrial membrane protein. The encoded protein may play a role in biogenesis of mitochondrial ATP synthase. Mutations in this gene have been associated with neonatal mitochondrial encephalocardiomyopathy due to ATP synthase deficiency. Alternatively spliced transcript variants have been described. | 
                                
                                    | Molecular Mass : | 29 kDa | 
                                
                                    | AA Sequence : | MLFLALGSPWAVELPLCGRRTALCAAAALRGPRASVSRASSSSGPSGPVAGWSTGPSGAARLLRRPGRAQIPVYWEGYVRFLNTPSDKSEDGRLIYTGNMARAVFGVKCFSYSTSLIGLTFLPYIFTQNNAISESVPLPIQIIFYGIMGSFTVITPVLLHFITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVKIPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDKTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
                                
                                    | Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
                                
                                    | Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. | 
                                
                                    | Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
                                
                                    | Concentration : | 50 μg/mL as determined by BCA | 
                                
                                    | Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |