Recombinant Human TMEM8B Protein, GST-Tagged

Cat.No. : TMEM8B-0185H
Product Overview : Human C9orf127 full-length ORF (AAH41377.1, 1 a.a. - 257 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : TMEM8B (Transmembrane Protein 8B) is a Protein Coding gene. Diseases associated with TMEM8B include Nasopharyngeal Carcinoma and Pharynx Cancer. An important paralog of this gene is TMEM8A.
Molecular Mass : 54.7 kDa
AA Sequence : MWRPHFHTCPPQSSVRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLLSVSATTRVARLRIPFPQTGTWFLALRSLCGVGPRFVRCRNATAEVRMRTFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTVCGGVCILSLGACAWWWVTVCISTTFSEGLGMSVPSLCLLQTETAVLPKLSCIDNGHFCKTHWSK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TMEM8B transmembrane protein 8B [ Homo sapiens ]
Official Symbol TMEM8B
Synonyms TMEM8B; transmembrane protein 8B; C9orf127, chromosome 9 open reading frame 127; NAG 5; nasopharyngeal carcinoma expressed 6; NGX6; Protein NGX6; protein NAG-5; nasopharyngeal carcinoma related protein; nasopharyngeal carcinoma-associated gene 6 protein; NAG-5; C9orf127; RP11-112J3.10; MGC120460;
Gene ID 51754
mRNA Refseq NM_001042589
Protein Refseq NP_001036054
MIM 616888
UniProt ID A6NDV4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMEM8B Products

Required fields are marked with *

My Review for All TMEM8B Products

Required fields are marked with *

0
cart-icon