Recombinant Human TMEM8B Protein, GST-Tagged
| Cat.No. : | TMEM8B-0185H |
| Product Overview : | Human C9orf127 full-length ORF (AAH41377.1, 1 a.a. - 257 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | TMEM8B (Transmembrane Protein 8B) is a Protein Coding gene. Diseases associated with TMEM8B include Nasopharyngeal Carcinoma and Pharynx Cancer. An important paralog of this gene is TMEM8A. |
| Molecular Mass : | 54.7 kDa |
| AA Sequence : | MWRPHFHTCPPQSSVRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLLSVSATTRVARLRIPFPQTGTWFLALRSLCGVGPRFVRCRNATAEVRMRTFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTVCGGVCILSLGACAWWWVTVCISTTFSEGLGMSVPSLCLLQTETAVLPKLSCIDNGHFCKTHWSK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | TMEM8B transmembrane protein 8B [ Homo sapiens ] |
| Official Symbol | TMEM8B |
| Synonyms | TMEM8B; transmembrane protein 8B; C9orf127, chromosome 9 open reading frame 127; NAG 5; nasopharyngeal carcinoma expressed 6; NGX6; Protein NGX6; protein NAG-5; nasopharyngeal carcinoma related protein; nasopharyngeal carcinoma-associated gene 6 protein; NAG-5; C9orf127; RP11-112J3.10; MGC120460; |
| Gene ID | 51754 |
| mRNA Refseq | NM_001042589 |
| Protein Refseq | NP_001036054 |
| MIM | 616888 |
| UniProt ID | A6NDV4 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM8B Products
Required fields are marked with *
My Review for All TMEM8B Products
Required fields are marked with *
