Recombinant Human TMEM9B Protein, GST-tagged
| Cat.No. : | TMEM9B-458H |
| Product Overview : | Human C11orf15 full-length ORF ( AAH40124, 34 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 43.89 kDa |
| AA Sequence : | AKNFEDVRCKCICPPYKENSGHIYNKNISQKDCDCLHVVEPMPVRGPDVEAYCLRCECKYEERSSVTIKVTIIIYLSILGLLLLYMVYLTLVEPILKRRLFGHAQLIQSDDDIGDHQPFANAHDVLARSRSRANVLNKVEYAQQRWKLQVQEQRKSVFDRHVVLS |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | TMEM9B TMEM9 domain family, member B [ Homo sapiens ] |
| Official Symbol | TMEM9B |
| Synonyms | C11orf15 |
| Gene ID | 56674 |
| mRNA Refseq | NM_020644.1 |
| Protein Refseq | NP_065695.1 |
| UniProt ID | Q9NQ34 |
| ◆ Recombinant Proteins | ||
| TMEM9B-17099M | Recombinant Mouse TMEM9B Protein | +Inquiry |
| RFL9826HF | Recombinant Full Length Human Transmembrane Protein 9B(Tmem9B) Protein, His-Tagged | +Inquiry |
| TMEM9B-458H | Recombinant Human TMEM9B Protein, GST-tagged | +Inquiry |
| TMEM9B-1796HF | Recombinant Full Length Human TMEM9B Protein, GST-tagged | +Inquiry |
| RFL29160MF | Recombinant Full Length Mouse Transmembrane Protein 9B(Tmem9B) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TMEM9B-921HCL | Recombinant Human TMEM9B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM9B Products
Required fields are marked with *
My Review for All TMEM9B Products
Required fields are marked with *
