Recombinant Human TMEM9B Protein, GST-tagged

• Cat.No.: TMEM9B-458H
• Product Overview: Human C11orf15 full-length ORF ( AAH40124, 34 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 43.89 kDa
• AA Sequence: AKNFEDVRCKCICPPYKENSGHIYNKNISQKDCDCLHVVEPMPVRGPDVEAYCLRCECKYEERSSVTIKVTIIIYLSILGLLLLYMVYLTLVEPILKRRLFGHAQLIQSDDDIGDHQPFANAHDVLARSRSRANVLNKVEYAQQRWKLQVQEQRKSVFDRHVVLS
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TMEM9B TMEM9 domain family, member B [ Homo sapiens ]
• Official Symbol: TMEM9B
• Synonyms: C11orf15
• Gene ID: 56674
• mRNA Refseq: NM_020644.1
• Protein Refseq: NP_065695.1
• UniProt ID: Q9NQ34