Recombinant Human TMEM9B Protein, GST-tagged

Cat.No. : TMEM9B-458H
Product Overview : Human C11orf15 full-length ORF ( AAH40124, 34 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 43.89 kDa
AA Sequence : AKNFEDVRCKCICPPYKENSGHIYNKNISQKDCDCLHVVEPMPVRGPDVEAYCLRCECKYEERSSVTIKVTIIIYLSILGLLLLYMVYLTLVEPILKRRLFGHAQLIQSDDDIGDHQPFANAHDVLARSRSRANVLNKVEYAQQRWKLQVQEQRKSVFDRHVVLS
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TMEM9B TMEM9 domain family, member B [ Homo sapiens ]
Official Symbol TMEM9B
Synonyms C11orf15
Gene ID 56674
mRNA Refseq NM_020644.1
Protein Refseq NP_065695.1
UniProt ID Q9NQ34

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMEM9B Products

Required fields are marked with *

My Review for All TMEM9B Products

Required fields are marked with *

0
cart-icon
0
compare icon