Recombinant Human TMOD1 protein, T7-tagged
Cat.No. : | TMOD1-175H |
Product Overview : | Recombinant human TMOD (359aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 359 a.a. |
Form : | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFMSYRRELEKYRDLDEDEILGALTEEELRTLENELDELDPDNALLPAGLRQKDQTTKAPTG PFKREELLDHLEKQAKEFKDREDLVPYTGEKRGKVWVPKQKPLDPVLESVTLEPELEEALANASDAELCDIAAIL GMHTLMSNQQYYQALSSSSIMNKEGLNSVIKPTQYKPVPDEEPNSTDVEETLERIKNNDPKLEEVNLNNIRNIPI PTLKAYAEALKENSYVKKFSIVGTRSNDPVAYALAEMLKENKVLKTLNVESNFISGAGILRLVEALPYNTSLVEM KIDNQSQPLGNKVEMEIVSMLEKNATLLKFGYHFTQQGPRLRASNAMMNNNDLVRKRRLADLTGPIIPKCRSGV |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro COP9 signalosome (CSN) regulation study with intracellular protein delivery of this protein.2. As soluble/native protein, may be used as enzymatic substrate protein for ubiquitin assay.3. May be used for mapping protein–protein interaction assay development.4. May be used as antigen for specific antibody development and potential cancer diagnostic development. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | TMOD1 tropomodulin 1 [ Homo sapiens ] |
Official Symbol | TMOD1 |
Synonyms | TMOD1; tropomodulin 1; D9S57E, TMOD; tropomodulin-1; ETMOD; E-Tmod; e-tropomodulin; erythrocyte tropomodulin; TMOD; D9S57E; |
Gene ID | 7111 |
mRNA Refseq | NM_001166116 |
Protein Refseq | NP_001159588 |
MIM | 190930 |
UniProt ID | P28289 |
Chromosome Location | 9q22 |
Pathway | Muscle contraction, organism-specific biosystem; Striated Muscle Contraction, organism-specific biosystem; Striated Muscle Contraction, organism-specific biosystem; |
Function | actin binding; tropomyosin binding; |
◆ Recombinant Proteins | ||
TMOD1-4197H | Recombinant Human TMOD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TMOD1-17104M | Recombinant Mouse TMOD1 Protein | +Inquiry |
TMOD1-31624TH | Recombinant Human TMOD1, T7 -tagged | +Inquiry |
TMOD1-6466H | Recombinant Human TMOD1 Protein (Pro39-His138), His tagged | +Inquiry |
TMOD1-553H | Recombinant Human TMOD1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMOD1-917HCL | Recombinant Human TMOD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMOD1 Products
Required fields are marked with *
My Review for All TMOD1 Products
Required fields are marked with *