Recombinant Human TMOD1 protein, T7-tagged

Cat.No. : TMOD1-175H
Product Overview : Recombinant human TMOD (359aa) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 359 a.a.
Form : 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFMSYRRELEKYRDLDEDEILGALTEEELRTLENELDELDPDNALLPAGLRQKDQTTKAPTG PFKREELLDHLEKQAKEFKDREDLVPYTGEKRGKVWVPKQKPLDPVLESVTLEPELEEALANASDAELCDIAAIL GMHTLMSNQQYYQALSSSSIMNKEGLNSVIKPTQYKPVPDEEPNSTDVEETLERIKNNDPKLEEVNLNNIRNIPI PTLKAYAEALKENSYVKKFSIVGTRSNDPVAYALAEMLKENKVLKTLNVESNFISGAGILRLVEALPYNTSLVEM KIDNQSQPLGNKVEMEIVSMLEKNATLLKFGYHFTQQGPRLRASNAMMNNNDLVRKRRLADLTGPIIPKCRSGV
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro COP9 signalosome (CSN) regulation study with intracellular protein delivery of this protein.2. As soluble/native protein, may be used as enzymatic substrate protein for ubiquitin assay.3. May be used for mapping protein–protein interaction assay development.4. May be used as antigen for specific antibody development and potential cancer diagnostic development.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name TMOD1 tropomodulin 1 [ Homo sapiens ]
Official Symbol TMOD1
Synonyms TMOD1; tropomodulin 1; D9S57E, TMOD; tropomodulin-1; ETMOD; E-Tmod; e-tropomodulin; erythrocyte tropomodulin; TMOD; D9S57E;
Gene ID 7111
mRNA Refseq NM_001166116
Protein Refseq NP_001159588
MIM 190930
UniProt ID P28289
Chromosome Location 9q22
Pathway Muscle contraction, organism-specific biosystem; Striated Muscle Contraction, organism-specific biosystem; Striated Muscle Contraction, organism-specific biosystem;
Function actin binding; tropomyosin binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMOD1 Products

Required fields are marked with *

My Review for All TMOD1 Products

Required fields are marked with *

0
cart-icon
0
compare icon