Recombinant Human TMOD2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TMOD2-5815H
Product Overview : TMOD2 MS Standard C13 and N15-labeled recombinant protein (NP_001136357) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. The encoded protein caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin. Alternatively spliced transcript variants encoding different isoforms have been described.
Molecular Mass : 35.5 kDa
AA Sequence : MALPFQKELEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPIETRKEEKVTLDPELEEALASASDTELYDLAAVLGVHNLLNNPKFDEETANNKGGKGPVRNVVKGEKVKPVFEEPPNPTNVEISLQQMKANDPSLQEVNLNNIKAFADMLKVNKTLTSLNIESNFITGTGILALVEALKENDTLTEIKIDNQRQQLGTAVEMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEADRRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TMOD2 tropomodulin 2 [ Homo sapiens (human) ]
Official Symbol TMOD2
Synonyms TMOD2; tropomodulin 2 (neuronal); tropomodulin-2; NTMOD; neuronal tropomodulin; N-TMOD; MGC39481;
Gene ID 29767
mRNA Refseq NM_001142885
Protein Refseq NP_001136357
MIM 602928
UniProt ID Q9NZR1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMOD2 Products

Required fields are marked with *

My Review for All TMOD2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon