Recombinant Human TMPRSS15 protein, His-tagged
| Cat.No. : | TMPRSS15-2772H |
| Product Overview : | Recombinant Human TMPRSS15 protein(48 - 324 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 07, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 48 - 324 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | RGAALGQSHEARATFKITSGVTYNPNLQDKLSVDFKVLAFDLQQMIDEIFLSSNLKNEYKNSRVLQFENGSIIVVFDLFFAQWVSDENVKEELIQGLEANKSSQLVTFHIDLNSVDILDKLTTTSHLATPGNVSIECLPGSSPCTDALTCIKADLFCDGEVNCPDGSDEDNKMCATVCDGRFLLTGSSGSFQATHYPKPSETSVVCQWIIRVNQGLSIKLSFDDFNTYYTDILDIYEGVGSSKILRASIWETNPGTIRIFSNQVTATFLIESDESDY |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | TMPRSS15 transmembrane protease, serine 15 [ Homo sapiens ] |
| Official Symbol | TMPRSS15 |
| Synonyms | TMPRSS15; transmembrane protease, serine 15; protease, serine, 7 (enterokinase) , PRSS7; enteropeptidase; ENTK; MGC133046; proenterokinase; enterokinase; serine protease 7; protease, serine, 7 (enterokinase); PRSS7; |
| Gene ID | 5651 |
| mRNA Refseq | NM_002772 |
| Protein Refseq | NP_002763 |
| MIM | 606635 |
| UniProt ID | P98073 |
| ◆ Recombinant Proteins | ||
| TMPRSS15-28570TH | Recombinant Human TMPRSS15 | +Inquiry |
| TMPRSS15-8322B | Recombinant Bovine TMPRSS15 protein | +Inquiry |
| TMPRSS15-5347B | Recombinant Bovine Transmembrane Protease, Serine 15 | +Inquiry |
| TMPRSS15-2134C | Recombinant Cattle TMPRSS15 Protein, His-tagged | +Inquiry |
| TMPRSS15-1993H | Recombinant Human TMPRSS15, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TMPRSS15-2800HCL | Recombinant Human PRSS7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMPRSS15 Products
Required fields are marked with *
My Review for All TMPRSS15 Products
Required fields are marked with *
