Recombinant Human TMPRSS15 protein, His-tagged
Cat.No. : | TMPRSS15-2772H |
Product Overview : | Recombinant Human TMPRSS15 protein(48 - 324 aa), fused to His tag, was expressed in E. coli. |
Availability | September 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 48 - 324 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | RGAALGQSHEARATFKITSGVTYNPNLQDKLSVDFKVLAFDLQQMIDEIFLSSNLKNEYKNSRVLQFENGSIIVVFDLFFAQWVSDENVKEELIQGLEANKSSQLVTFHIDLNSVDILDKLTTTSHLATPGNVSIECLPGSSPCTDALTCIKADLFCDGEVNCPDGSDEDNKMCATVCDGRFLLTGSSGSFQATHYPKPSETSVVCQWIIRVNQGLSIKLSFDDFNTYYTDILDIYEGVGSSKILRASIWETNPGTIRIFSNQVTATFLIESDESDY |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TMPRSS15 transmembrane protease, serine 15 [ Homo sapiens ] |
Official Symbol | TMPRSS15 |
Synonyms | TMPRSS15; transmembrane protease, serine 15; protease, serine, 7 (enterokinase) , PRSS7; enteropeptidase; ENTK; MGC133046; proenterokinase; enterokinase; serine protease 7; protease, serine, 7 (enterokinase); PRSS7; |
Gene ID | 5651 |
mRNA Refseq | NM_002772 |
Protein Refseq | NP_002763 |
MIM | 606635 |
UniProt ID | P98073 |
◆ Recombinant Proteins | ||
TMPRSS15-1993H | Recombinant Human TMPRSS15, GST-tagged | +Inquiry |
TMPRSS15-02H | Recombinant Bovine TMPRSS15 Protein, His-tagged | +Inquiry |
Tmprss15-2135R | Recombinant Rat Tmprss15 Protein, His-tagged | +Inquiry |
TMPRSS15-2088M | Recombinant Mouse TMPRSS15 Protein (830-1069 aa), His-SUMO-tagged | +Inquiry |
TMPRSS15-1457B | Recombinant Bovine TMPRSS15 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TMPRSS15-001H | Recombinant Human TMPRSS15 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMPRSS15-2800HCL | Recombinant Human PRSS7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMPRSS15 Products
Required fields are marked with *
My Review for All TMPRSS15 Products
Required fields are marked with *