Recombinant Human TMPRSS2 Protein(106-492aa), MBP&His-Avi-tagged, Biotinylated
| Cat.No. : | TMPRSS2-05943H |
| Product Overview : | Biotinylated Recombinant Human TMPRSS2 Protein(106-492aa)(O15393), fused with N-terminal MBP tag and C-terminal His and Avi tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Avi&His&MBP |
| Protein Length : | 106-492aa |
| Conjugation/Label : | Biotin |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 90.6 kDa |
| AA Sequence : | WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Conjugation : | Biotin |
| Gene Name | TMPRSS2 transmembrane protease, serine 2 [ Homo sapiens ] |
| Official Symbol | TMPRSS2 |
| Synonyms | TMPRSS2; transmembrane protease, serine 2; transmembrane protease serine 2; PRSS10; epitheliasin; serine protease 10; PP9284; FLJ41954; |
| Gene ID | 7113 |
| mRNA Refseq | NM_001135099 |
| Protein Refseq | NP_001128571 |
| MIM | 602060 |
| UniProt ID | O15393 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMPRSS2 Products
Required fields are marked with *
My Review for All TMPRSS2 Products
Required fields are marked with *



