Recombinant Human TMPRSS2 Protein(106-492aa), MBP&His-Avi-tagged, Biotinylated
Cat.No. : | TMPRSS2-05943H |
Product Overview : | Biotinylated Recombinant Human TMPRSS2 Protein(106-492aa)(O15393), fused with N-terminal MBP tag and C-terminal His and Avi tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Avi&His&MBP |
Protein Length : | 106-492aa |
Conjugation/Label : | Biotin |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 90.6 kDa |
AA Sequence : | WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | TMPRSS2 transmembrane protease, serine 2 [ Homo sapiens ] |
Official Symbol | TMPRSS2 |
Synonyms | TMPRSS2; transmembrane protease, serine 2; transmembrane protease serine 2; PRSS10; epitheliasin; serine protease 10; PP9284; FLJ41954; |
Gene ID | 7113 |
mRNA Refseq | NM_001135099 |
Protein Refseq | NP_001128571 |
MIM | 602060 |
UniProt ID | O15393 |
◆ Recombinant Proteins | ||
Tmprss2-429R | Recombinant Rat Tmprss2 Protein, His-tagged | +Inquiry |
TMPRSS2-123H | Recombinant Human TMPRSS2 Protein | +Inquiry |
TMPRSS2-1856H | Recombinant Human TMPRSS2 Protein (106-492 aa), His-tagged | +Inquiry |
TMPRSS2-4593H | Recombinant Human TMPRSS2 protein, His-SUMO-tagged | +Inquiry |
TMPRSS2-4595H | Active Recombinant Human TMPRSS2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TMPRSS2-011H | Recombinant Human TMPRSS3 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMPRSS2-910HCL | Recombinant Human TMPRSS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMPRSS2 Products
Required fields are marked with *
My Review for All TMPRSS2 Products
Required fields are marked with *
0
Inquiry Basket