Recombinant Human TMPRSS2 protein, His-tagged
Cat.No. : | TMPRSS2-4598H |
Product Overview : | Recombinant Human TMPRSS2 protein(O15393)(106-492aa (R255Q)), fused to N-terminal His tag, was expressed in Mammalian cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | His |
Protein Length : | 106-492aa (R255Q) |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
AA Sequence : | WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | TMPRSS2 transmembrane protease, serine 2 [ Homo sapiens ] |
Official Symbol | TMPRSS2 |
Synonyms | TMPRSS2; transmembrane protease, serine 2; transmembrane protease serine 2; PRSS10; epitheliasin; serine protease 10; PP9284; FLJ41954; |
Gene ID | 7113 |
mRNA Refseq | NM_001135099 |
Protein Refseq | NP_001128571 |
MIM | 602060 |
UniProt ID | O15393 |
◆ Recombinant Proteins | ||
Tmprss2-4893M | Recombinant Mouse Tmprss2 protein, His-tagged | +Inquiry |
TMPRSS2-70H | Recombinant Human TMPRSS2 protein, GST-tagged | +Inquiry |
TMPRSS2-4598H | Recombinant Human TMPRSS2 protein, His-tagged | +Inquiry |
TMPRSS2-1856H | Recombinant Human TMPRSS2 Protein (106-492 aa), His-tagged | +Inquiry |
TMPRSS2-1912Z | Recombinant Zebrafish TMPRSS2 | +Inquiry |
◆ Native Proteins | ||
TMPRSS2-011H | Recombinant Human TMPRSS3 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMPRSS2-910HCL | Recombinant Human TMPRSS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMPRSS2 Products
Required fields are marked with *
My Review for All TMPRSS2 Products
Required fields are marked with *
0
Inquiry Basket