Recombinant Human TMPRSS6 protein, GST-tagged
Cat.No. : | TMPRSS6-126H |
Product Overview : | Recombinant Human TMPRSS6(1 a.a. - 461 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1 a.a. - 461 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 78 kDa |
AA Sequence : | MLLLFHSKRMPVAEAPQVAGGQGDGGDGEEAEPEGMFKACEDSKRKARGYLRLVPLFVLLALLVLASAGVLLWYF LGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQKMLKELITSTRLGTYYNSSSVYSFGEGPLTC FFWFILQIPEHRRLMLSPEVVQALLVEELLSTVNSSAAVPYRAEYEVDPEGLVILEASVKDIAALNSTLGCYRYS YVGQGQVLRLKGPDHLASSCLWHLQGPKDLMLKLRLEWTLAECRDRLAMYDVAGPLEKRLITSVYGCSRQEPVVE VLASGAIMAVVWKKGLHSYYDPFVLSVQPVVFQACEVNLTLDNRLDSQGVLSTPYFPSYYSPQTHCSWHLTVPSL DYGLALWFDAYALRRQKYDLPCTQGQWTIQNRRYHFLSSLWLPFLPPPPSLPSSTVTPSLEAQVPNLRGAARGAS RGWGWCQACCP |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TMPRSS6 transmembrane protease, serine 6 [ Homo sapiens ] |
Official Symbol | TMPRSS6 |
Synonyms | TMPRSS6; transmembrane protease, serine 6; transmembrane protease serine 6; FLJ30744; matriptase-2; type II transmembrane serine protease 6; membrane-bound mosaic serine proteinase matriptase-2; IRIDA; |
Gene ID | 164656 |
mRNA Refseq | NM_153609 |
Protein Refseq | NP_705837 |
MIM | 609862 |
UniProt ID | Q8IU80 |
Chromosome Location | 22q13.1 |
Function | peptidase activity; serine-type endopeptidase activity; |
◆ Recombinant Proteins | ||
TMPRSS6-3247HFL | Recombinant Full Length Human TMPRSS6 protein, Flag-tagged | +Inquiry |
TMPRSS6-17123M | Recombinant Mouse TMPRSS6, His-MYC-tagged | +Inquiry |
TMPRSS6-2746M | Recombinant Mouse TMPRSS6 Protein (81-811 aa), His-Myc-tagged | +Inquiry |
TMPRSS6-126H | Recombinant Human TMPRSS6 protein, GST-tagged | +Inquiry |
TMPRSS6-430H | Recombinant Human TMPRSS6 Protein, His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMPRSS6-1799HCL | Recombinant Human TMPRSS6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMPRSS6 Products
Required fields are marked with *
My Review for All TMPRSS6 Products
Required fields are marked with *
0
Inquiry Basket