Recombinant Human TMSB10 protein, GST-tagged
| Cat.No. : | TMSB10-8553H |
| Product Overview : | Recombinant Human TMSB10 protein(1-44 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 1-44 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS |
| Purity : | 90%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | TMSB10 thymosin beta 10 [ Homo sapiens ] |
| Official Symbol | TMSB10 |
| Synonyms | TMSB10; thymosin beta 10; thymosin beta-10; TB10; migration-inducing gene 12; migration-inducing protein 12; MIG12; |
| mRNA Refseq | NM_021103 |
| Protein Refseq | NP_066926 |
| MIM | 188399 |
| UniProt ID | P63313 |
| Gene ID | 9168 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMSB10 Products
Required fields are marked with *
My Review for All TMSB10 Products
Required fields are marked with *



