Recombinant Human TMUB2 protein, GST-tagged
Cat.No. : | TMUB2-3617H |
Product Overview : | Recombinant Human TMUB2 protein(101-230 aa), fused to GST tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 101-230 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | HPSEGNDEKAEEAGEGRGDSTGEAGAGGGVEPSLEHLLDIQGLPKRQAGAGSSSPEAPLRSEDSTCLPPSPGLITVRLKFLNDTEELAVARPEDTVGALKSKYFPGQESQMKLIYQGRLLQDPARTLRSL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TMUB2 transmembrane and ubiquitin-like domain containing 2 [ Homo sapiens ] |
Official Symbol | TMUB2 |
Synonyms | TMUB2; transmembrane and ubiquitin-like domain containing 2; transmembrane and ubiquitin-like domain-containing protein 2; MGC3123; FP2653; |
Gene ID | 79089 |
mRNA Refseq | NM_001076674 |
Protein Refseq | NP_001070142 |
UniProt ID | Q71RG4 |
◆ Recombinant Proteins | ||
TMUB2-9465M | Recombinant Mouse TMUB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL20867RF | Recombinant Full Length Rat Transmembrane And Ubiquitin-Like Domain-Containing Protein 2(Tmub2) Protein, His-Tagged | +Inquiry |
TMUB2-1417Z | Recombinant Zebrafish TMUB2 | +Inquiry |
TMUB2-17137M | Recombinant Mouse TMUB2 Protein | +Inquiry |
TMUB2-5750H | Recombinant Human TMUB2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMUB2-786HCL | Recombinant Human TMUB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMUB2 Products
Required fields are marked with *
My Review for All TMUB2 Products
Required fields are marked with *
0
Inquiry Basket