Recombinant Human TMX1 protein, His-tagged

Cat.No. : TMX1-2765H
Product Overview : Recombinant Human TMX1 protein(202-280 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability November 15, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 202-280 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : VADCLCPSKRRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol TMX1
Synonyms TMX1; thioredoxin-related transmembrane protein 1; thioredoxin domain containing , thioredoxin domain containing 1 , thioredoxin domain containing , TXNDC, TXNDC1; PDIA11; protein disulfide isomerase family A; member 11; thioredoxin related transmembrane protein; TMX; thioredoxin domain containing 1; transmembrane Trx-related protein; thioredoxin domain-containing protein 1; protein disulfide isomerase family A, member 11; TXNDC; TXNDC1; DKFZp564E1962;
Gene ID 81542
mRNA Refseq NM_030755
Protein Refseq NP_110382
MIM 610527
UniProt ID Q9H3N1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMX1 Products

Required fields are marked with *

My Review for All TMX1 Products

Required fields are marked with *

0
cart-icon
0
compare icon