Recombinant Human TMX2 protein, GST-tagged

Cat.No. : TMX2-7842H
Product Overview : Recombinant Human TMX2 protein(130-296 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 130-296 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : PLYMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol TMX2
Synonyms PIG26; CGI-31; PDIA12; TXNDC14
Gene ID 51075
mRNA Refseq NM_015959.3
Protein Refseq NP_057043.1
UniProt ID Q9Y320

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMX2 Products

Required fields are marked with *

My Review for All TMX2 Products

Required fields are marked with *

0
cart-icon
0
compare icon