Recombinant Human TMX2 protein, GST-tagged
Cat.No. : | TMX2-7842H |
Product Overview : | Recombinant Human TMX2 protein(130-296 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 130-296 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | PLYMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | TMX2 |
Synonyms | PIG26; CGI-31; PDIA12; TXNDC14 |
Gene ID | 51075 |
mRNA Refseq | NM_015959.3 |
Protein Refseq | NP_057043.1 |
UniProt ID | Q9Y320 |
◆ Recombinant Proteins | ||
TMX2-5849R | Recombinant Rat TMX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMX2-7842H | Recombinant Human TMX2 protein, GST-tagged | +Inquiry |
TMX2-494H | Recombinant Human TMX2 Protein, His-tagged | +Inquiry |
TMX2-249H | Recombinant Human TMX2 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Tmx2-6535M | Recombinant Mouse Tmx2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMX2-899HCL | Recombinant Human TMX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMX2 Products
Required fields are marked with *
My Review for All TMX2 Products
Required fields are marked with *
0
Inquiry Basket