Recombinant Human TMX2 Protein, His-tagged

Cat.No. : TMX2-494H
Product Overview : Recombinant Human TMX2, transcript variant 1, fused with His tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : THis gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, one transmembrane domain and a C-terminal ER-retention sequence. THis protein is enriched on the mitochondria-associated-membrane of the ER via palmitoylation of two of its cytosolically exposed cysteines.
Form : Lyophilized from a 0.2 µM filtered solution of 20mM Tris, 150mM NaCl, pH8.0
Molecular Mass : 21.9kD
AA Sequence : MGSSHHHHHHSSGLVPRGSHMTCKPPLYMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name TMX2 thioredoxin-related transmembrane protein 2 [ Homo sapiens ]
Official Symbol TMX2
Synonyms PIG26; CGI-31; PDIA12; TXNDC14
Gene ID 51075
mRNA Refseq NM_015959.3
Protein Refseq NP_057043.1
UniProt ID Q9Y320

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMX2 Products

Required fields are marked with *

My Review for All TMX2 Products

Required fields are marked with *

0
cart-icon
0
compare icon