Recombinant Human TMX2 Protein, His-tagged
Cat.No. : | TMX2-494H |
Product Overview : | Recombinant Human TMX2, transcript variant 1, fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | THis gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, one transmembrane domain and a C-terminal ER-retention sequence. THis protein is enriched on the mitochondria-associated-membrane of the ER via palmitoylation of two of its cytosolically exposed cysteines. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM Tris, 150mM NaCl, pH8.0 |
Molecular Mass : | 21.9kD |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMTCKPPLYMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | TMX2 thioredoxin-related transmembrane protein 2 [ Homo sapiens ] |
Official Symbol | TMX2 |
Synonyms | PIG26; CGI-31; PDIA12; TXNDC14 |
Gene ID | 51075 |
mRNA Refseq | NM_015959.3 |
Protein Refseq | NP_057043.1 |
UniProt ID | Q9Y320 |
◆ Recombinant Proteins | ||
TMX2-7842H | Recombinant Human TMX2 protein, GST-tagged | +Inquiry |
TMX2-3312H | Recombinant Human TMX2, GST-tagged | +Inquiry |
TMX2-5893H | Recombinant Human TMX2 Protein (Met125-Lys296), N-His tagged | +Inquiry |
TMX2-7843H | Recombinant Human TMX2 protein, His-tagged | +Inquiry |
TMX2-5849R | Recombinant Rat TMX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMX2-899HCL | Recombinant Human TMX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMX2 Products
Required fields are marked with *
My Review for All TMX2 Products
Required fields are marked with *
0
Inquiry Basket