Recombinant Human TNFAIP3 Protein, GST-tagged
| Cat.No. : | TNFAIP3-2156H |
| Product Overview : | Human TNFAIP3 partial ORF ( NP_006281, 691 a.a. - 790 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene was identified as a gene whose expression is rapidly induced by the tumor necrosis factor (TNF). The protein encoded by this gene is a zinc finger protein and ubiqitin-editing enzyme, and has been shown to inhibit NF-kappa B activation as well as TNF-mediated apoptosis. The encoded protein, which has both ubiquitin ligase and deubiquitinase activities, is involved in the cytokine-mediated immune and inflammatory responses. Several transcript variants encoding the same protein have been found for this gene. |
| Form : | Liquid |
| Molecular Mass : | 36.74 kDa |
| AA sequence : | RTEEQLRSSQRRDVPRTTQSTSRPKCARASCKNILACRSEELCMECQHPNQRMGPGAHRGEPAPEDPPKQRCRAPACDHFGNAKCNGYCNECFQFKQMYG |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | TNFAIP3 tumor necrosis factor, alpha-induced protein 3 [ Homo sapiens ] |
| Official Symbol | TNFAIP3 |
| Synonyms | TNFAIP3; tumor necrosis factor, alpha-induced protein 3; tumor necrosis factor alpha-induced protein 3; A20; OTUD7C; TNFAIP3 (A20); zinc finger protein A20; TNF alpha-induced protein 3; OTU domain-containing protein 7C; putative DNA-binding protein A20; tumor necrosis factor inducible protein A20; TNFA1P2; MGC104522; MGC138687; MGC138688 |
| Gene ID | 7128 |
| mRNA Refseq | NM_006290 |
| Protein Refseq | NP_006281 |
| MIM | 191163 |
| UniProt ID | P21580 |
| ◆ Recombinant Proteins | ||
| TNFAIP3-6192HF | Recombinant Full Length Human TNFAIP3 Protein, GST-tagged | +Inquiry |
| TNFAIP3-6473H | Recombinant Human TNFAIP3 Protein (Met1-Gly790), N-GST tagged | +Inquiry |
| TNFAIP3-566H | Recombinant Human TNFAIP3 protein, His-tagged | +Inquiry |
| TNFAIP3-4676R | Recombinant Rhesus Macaque TNFAIP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Tnfaip3-6542M | Recombinant Mouse Tnfaip3 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFAIP3 Products
Required fields are marked with *
My Review for All TNFAIP3 Products
Required fields are marked with *
